Algoritmus

Mohl by nějaký algoritmus vzniknout samovolně (spontánně) bez působení inteligentní osoby?

pavelkabrt Genetika-teorie informace 199 Koment.

Tvorba (genetických) algoritmů [GA]

Václav Dostál

Tento článek jsem vytvořil na základě textů, uvedených v hypertextových odkazech. Pro mé úvahy přitom významnou roli hrály texty W. Gitta, J. Potočky a T. T. Akiry. Článek také reaguje na některé „argumenty“ evolucionistů, zapojených do diskuzí na webu.

Pokud by se otázka týkala „vzniku“ algoritmu, používaného ve výpočetní technice, odpověď by zněla, že samozřejmě ne. Někdo by dokonce dodal, že jde o hloupou otázku, kterou není vůbec nutné klást. Jestliže však jde o genetický nebo evoluční algoritmus, pak už se budou odpovědi lišit. Genetické algoritmy totiž podle definice napodobují evoluci v přírodě, o níž celá spousta lidí předpokládá, že proběhla. Dodají, že to přece už odhalil Charles Darwin a že v přírodě či v přírodní vědě – zejména v biologii – nemá bez evoluce nic smysl. Z toho potom logicky vyplývá, že algoritmy, obsahující instrukce (povely či příkazy, data nebo adresy) pro živé organismy se vyvinuly samovolně, bez jakéhokoliv působení nějaké inteligence, přesněji bez nutnosti Tvůrce (Stvořitele). Zde platí, že ze špatného výchozího předpokladu dojdeme pomocí správné logiky k nesprávnému výsledku.

Je podivné, že některé algoritmy – používané v technice či ve výrobě – své tvůrce potřebují a jiné – zaznamenané v živých organismech – žádného tvůrce nepotřebují. Ty druhé – nazvěme je „přirozené“ – by měly vznikat „přirozeně“ a ne „nadpřirozeně.“ Jenže z čeho a jak? Odkud se vzala prvotní instrukce pro samovolný vznik protobuňky? Jak se z této jednoduché informace stal celý postup, zvaný algoritmus? A jak se tyto algoritmy samovolně spojily do velmi složitého programu, zaznamenaného v DNA u lidí?

Už tyto počáteční otázky naznačují, že samovolný vývoj, zvaný evoluce (přesněji: makroevoluce) je velmi špatným řešením otázky existence života na Zemi. Přitom vznik a/nebo rozvoj života někde jinde – na jiné planetě nebo ve volném kosmickém prostoru – je tímtéž problémem. Jeho řešení pomocí evoluce – zejména samovolná evoluce genetických či evolučních algoritmů nutných pro život – je zcela stejně špatné jako pro naši planetu.

Zbývá tedy jediná možnost. Instrukce, algoritmy a programy pro život nevznikly samovolně, ale byly vytvořeny neboli stvořeny. Jejich existenci umožnil Tvůrce neboli Stvořitel. Ten je vymyslel, sestavil a umístil (implementoval) na patřičná, tj. jím určená, místa v DNA nebo obecně v organismu.

Tento závěr je ovšem pro řadu lidí nepřijatelný. Budou tvrdit, že jde o náboženství a ne o vědu. Přitom ve skutečnosti jde o logiku – a to je také věda! Nebo existuje třetí možnost, že život ani nevznikl samovolně, ani jej nikdo nevytvořil (nestvořil)?  Jak by tato třetí možnost vypadala? Otázku lze obejít tím, že ji nebudeme vůbec klást a tedy ani náznakem řešit. Člověk je však tvor zvídavý a tak odsunutím nebo zamítnutím této otázky si předem klade velkou mez ve svém poznávání světa.

Zapálení zastánci evoluce namítnou, že genetický algoritmus obsahuje zvláštní operace, tj. operace mutace a křížení, které jiné algoritmy neobsahují. Jsou však tyto operace příčinou zásadní či principiální odlišnosti genetických algoritmů od jiných, která by odůvodňovala jejich samovolný vznik a ještě k tomu jen u živých organismů? Genetické algoritmy totiž patří mezi optimalizační výrobní – technické. Neexistuje žádný (umělý) genetický algoritmus, který by řídil nějaký umělý život, byť na elementární úrovni. Algoritmy tzv. umělé inteligence neřídí živé organismy, ale jisté stroje, jimž se říká „inteligentní.“ Mezi tyto stroje patří např. roboty, nebo dokonce celé výrobní linky – složené z různých výrobních strojů a robotů. Taková linka pracuje samočinně (automaticky), ale ne samovolně – bez vloženého programu, vytvořeného celým programátorským týmem.

A co třeba kardiostimulátor? Tento sofistikovaný přístroj přece řídí srdce, ne? Ale kdepak, jen upravuje vzniklou arytmii na rytmický „tlukot“ srdce. Bez programu, uloženého v jisté části mozku, i když se v něm vyskytla řídící chyba, by byl k ničemu.

Hierarchie informací při řízení a „vývoj“ programu

Nejnižší řídící jednotkou je instrukce. Může to být povel (příkaz), údaj nebo adresa. Příkaz říká, co se má provést, jaká funkce má nastat. Nejjednodušší je čítač, tedy „počitadlo“, který přikazuje, aby se hodnota matematické proměnné zvětšila o jedničku. Mívá tvar: N = N +1. Před tímto příkazem musí být zadána výchozí hodnota, nejčastěji jednička: N = 1. V algoritmu, obsahujícím počáteční hodnotu a čítač bude smyčka (cyklus), která bude průběh vracet k čítači. Při druhém průchodu tedy proměnná N nabude hodnoty 2, při třetím 3, atd. Prostě se počítá počet průchodů smyčkou. V této smyčce musí být podmínka jejího ukončení. Nejjednodušší bude zadání maximální hodnoty, při níž se skočí ven ze smyčky. Bude znít: Je-li N = dané maximální hodnotě, potom jdi na další řádek (pokyn). Velmi jednoduchými příkazy budou „Začni“ a „Skonči“ (které budou doplněny: nějak to oznam – např. vypiš na monitor titulek).

Údaj udává hodnotu. Výše jsem uvedl údaj počáteční hodnoty čítače. Několik údajů tvoří data nebo dokonce databanku (velký soubor dat). Z uvedeného vyplývá, že může jít o číselnou hodnotu. Ta bývá vyjádřena součinem velikosti v nultém číselném řádu a mocniny desítky. Tak, jak jsme to zvyklí u velikých či malinkých čísel. Např. 2,34.10^6 (v programu: 2,34 E6, kde E = exponent) nebo 9,87.10^–15 (či raději: 9,87 E–15).

Adresa je (pořadové) číslo, udávající polohu části algoritmu (např. smyčky) v celém algoritmu. Je to obdoba čísla domu, v němž bydlíme. Na tuto adresu je v jiné části algoritmu či programu odkaz. Jakmile doběhne určitá část algoritmu, musí bezprostředně následovat povel, kde (od kterého místa) má algoritmus pokračovat. Bez určení adresy algoritmus neví, odkud má pokračovat a tak by mohl nepokračovat vůbec – i když ještě pokračovat má.

Jednotlivé instrukce jsou seřazeny do algoritmu. Algoritmus už určuje jednoduchý průběh podle zadané funkce. Algoritmus je tedy několik instrukcí, řádně sestavených do určitého pořadí. Skládá se z několika řádků, na každém řádku je jedna instrukce. Algoritmus musí být: 1. konečný, 2. univerzální (pro podobné úlohy), jednoznačně určený, 3. s výstupem (a samozřejmě se vstupem), 4. co nejjednodušší a 5. co nejelegantnější. Může být lineární (při sériovém řazení instrukcí), větvený (paralelní) nebo kombinovaný.

Z výčtu vlastností algoritmu je zřejmé, že nemůže vznikat náhodným řazením jednotlivých instrukcí, kdy by tyto instrukce nějak samy od sebe „skákaly“ na nějaká náhodná místa v algoritmu. Žádné vnější podmínky (teplota, tlak, záření, atd.) neuspořádají instrukce do funkčního algoritmu. Mohou ovšem zničit zápis algoritmu. Např. zápis na papíře při požáru shoří. Nemožnost samovolného vzniku algoritmu jen pomocí vnějších podmínek platí i pro ty algoritmy, jež jsou uloženy v živém organismu. (Zde se opakuji, ale myslím, že ne bezdůvodně).

Několik algoritmů vzájemně propojených vytvoří program. Program přesně a jednoznačně určuje, co a jak se má dít. Řídí daný proces a má tytéž vlastnosti jako algoritmus (konečnost, jednoznačnost, atd.). Je zřejmé, že ke „vzniku“ programu je zapotřebí inteligentních lidí, tzv. programátorů neboli „moderně“ „ajťáků.“ Postup, jímž programátoři nějaký program vytvářejí, se nazývá programování. Program se obvykle vkládá („implementuje“) do počítače nebo do sítě počítačů, v níž je aspoň jeden řídící počítač („server“). V minimálním provedení jde o „kartu“ s elektronickými obvody – například v automatické pračce. Jedna část karty je paměť, do níž jsou prací programy implementovány.

Programátoři sestavují program v nějakém programovacím jazyku, který je v počítači přeměňován – překódován, překládán na tzv. strojový kód. Strojový kód obsahuje strojové instrukce (a tedy i algoritmy a celý program) v číselném tvaru. Jednotlivé číselné kódy mají svůj význam, který byl předem stanoven a jemuž se příslušné počítače či sítě podřizují. Jedno číslo může znamenat buď adresu nebo povel nebo znak (písmeno, rovnítko, údaj), přičemž se význam může přepínat, takže soustava číselných kódů je potom přehledně sestavena do kódovací tabulky. Tato tabulka pak obsahuje zakódovaná písmena latinky, řecké abecedy, arabské abecedy, čísla, grafické znaky, povely, atd. Přiřazením více významů jednomu číslu ve strojovém kódu se ušetří spousta místa zejména v paměti a na disku či ve flešce.

O kódování se může každý dovědět např. zde. Do strojového (tj. číselného) kódu musí být zakódována nejen čísla, ale také text, zvuk a obraz. Překlad (překódování) je rozebrán tady. Jeho jednotlivé části jsou tu, tuhle, tadyhle, tuto a tuná.

Program „se“ vyvíjí, vlastně jej vyvíjí či lépe řečeno vytváří programátor nebo tým programátorů. Programátor takový program nejprve navrhuje a potom jej „ladí.“ Při návrhu obvykle nejdříve určí účel programu, soubor dat a jejich označení i tvar výsledků. Určí způsoby zpracování (použité matematické funkce, druh matematických algoritmů, aj.). Data, která nemají matematický tvar (např. pravidla pravopisu) musí přitom být zakódována do číselného tvaru. Datové typy jsou: logické hodnoty (0 či 1), celá čísla, reálná čísla, pole, textové řetězce (slova v mateřském jazyku), seznamy, ukazatele, soubory, komplexní čísla. Je zřejmé, že např. iracionální čísla (např. Ö2, e, p) nemohou být uložena přesně, protože nelze uložit nekonečný počet desetinných míst).

Představa, že program pro živý organismus vzniká a vyvíjí se sám, bez působení inteligentního programátora, je nesmyslná. Z jaké hmoty vznikne nápad o určení a chodu programu sám od sebe? Čím je program složitější, tím více potřebuje tvůrčího myšlení a praktického uskutečňování těch myšlenek pomocí konkrétních a jednoznačně vybraných instrukcí a dat.

Genetický algoritmus

Podle wikipedie je obecné schéma algoritmu toto:

  1. Vytvoř nultou populaci (obvykle složenou z náhodně vygenerovaných jedinců)
  2. Začátek cyklu. Pomocí určité výběrové metody (zpravidla zčásti náhodné) vyber z populace několik jedinců s vysokou zdatností
  3. Z vybraných jedinců vygeneruj nové použitím následujících metod (operátorů), čímž vznikne další generace:
    • křížení – „prohoď“ části několika jedinců mezi sebou
    • mutace – náhodně změň část jedince
    • reprodukce – kopíruj jedince beze změny
  4. Vypočti zdatnost těchto nových jedinců
  5. Konec cyklu. Pokud není splněna zastavovací podmínka, tak pokračuj od bodu 2
  6. Konec algoritmu. Jedinec s nejvyšší zdatností je hlavním výstupem algoritmu a reprezentuje nejlepší nalezené řešení.

Podle Lunera:

t := 0
Initialize G(0) inicializuj počáteční generaci
Evaluate G(0) proveď ohodnocení
do while not Done dokud není splněna ukončovací podmínka, proveď  t := t + 1
Select G(t) from G(t-1) proveď přirozený výběr
Crossover G(t) aplikuj křížení
Mutate G(t) aplikuj mutaci
 Evaluate G(t) proveď ohodnocení
loop

Genetický algoritmus kromě křížení a mutace tedy obsahuje obecně užívané instrukce: začátek cyklu, konec cyklu, čítač (počitadlo), počáteční a horní hodnotu čítače, skok při splnění horní meze čítače, druh funkce a její výpočet. Všechny, tj. běžné i zvláštní algoritmy (genetické) mají tytéž vlastnosti, které jsem uvedl výše (např. konečnost).

V kapitole „Jak genetické algoritmy pracují“ Luner uvádí: „Nejprve je třeba vybrat nějakou počáteční populaci přípustných řešení. To se děje většinou náhodně, ale máme-li k dispozici nějaké heuristiky, můžeme je uplatnit právě v tomto kroku.“ Zde bude hrát velkou roli intuice, protože není možné zkoušet nekonečně nebo velmi mnoho alternativ. Příkazem ve skutečnosti je celistvá část generování pseudonáhodného čísla z intervalu  se zaokrouhlením na celé číslo, jehož výsledkem je buď 0, nebo 1. Tento příkaz se má provést opakovaně, tzn. ve smyčce. Takto se vygeneruje celý osmibitový bajt, který se zde nazývá „jedinec“ nebo „chromozom.“ Po vygenerování určitého počtu jedinců neboli po vygenerování populace jedinců (počtu bajtů) následuje ohodnocení jedinců (fitness), a to podle počtu jedniček. Výsledek by pak vypadal takto (cituji z daného textu):

„jedinec ohodnocení
A 00010000 1
B 11011101 6
C 10000100 2
D 01100001 3“

Algoritmus bude pokračovat výběrem stejného počtu bajtů (jedinců) podle ohodnocení. Takže vznikne nová „populace“ B, D, B, C. „Dále budeme aplikovat křížení. To se děje podle nějaké předem dané pravděpodobnosti. Pro jednoduchost předpokládejme, že se uplatní u páru B, D a u páru B, C nikoliv.“ Křížení totiž může nastat jen u páru jedinců.

Dalším příkazem je mutace. „Pro pár B, D tedy určíme náhodně pozici. Nechť je to např. hned první pozice. Provedeme výměnu konců řetězců a dostaneme tak dva nové jedince E=11100001 a F=01011101. Nyní na každý z jedinců E, F, B, C může být aplikována mutace. Předpokládejme, že se tak stane u jedince B, a to např. na páté pozici. Dostaneme tedy B’=11010101. Nová generace bude vypadat takto:

jedinec ohodnocení
E 11100001 4
F 01011101 5
B’11010101 5
C 10000100 2

Můžete si povšimnout, že maximální ohodnocení v nové generaci je menší (klesnulo ze 6 na 5), průměrné ohodnocení se však zvýšilo.“

Vypadá to skvostně. Jenže údajná historická evoluce takto probíhat nemohla. Každý bajt v příkladech je kódem určitého skutečného biologického jedince a v něm každý bit představuje určitou vlastnost tohoto organismu. Jestliže je hodnota určitého bitu (např. čtvrtého v pořadí zleva) u některého jedince jiná, má tedy tento jedinec danou vlastnost (již ten bit kóduje) jinou. Zde se jedinec E liší od jedince F a B´, ale ne od jedince C. Vlastnosti jedinců se v globálu v populaci jedinců liší poměrně značně a vzniká otázka, zda jde jen o malou změnu nebo zda se populace už od počátku skládá z naprosto odlišných jedinců, kteří nemohou být zahrnuti do jednoho druhu organismu. Tou odlišnou vlastností není „fitness“, tedy schopnost přežití, ale může to být schopnost vidění, slyšení, nebo něco jiného!

Autor nezapomněl uvést:

„Jaké jsou hlavní výhody GA [genetického algoritmu]?

  • nevyžadují žádné speciální znalosti o cílové funkci
  • jsou odolné vůči sklouznutí do lokálního optima
  • vykazují velmi dobré výsledky u problémů s rozsáhlými množinami přípustných řešení
  • mohou být využity pro nejrozmanitější optimalizační problémy

Jaké jsou hlavní nevýhody GA?

  • mají problém s nalezením přesného optima
  • vyžadují velké množství vyhodnocování cílové funkce
  • jejich implementace není vždy přímočará.“

Také z tohoto je zřejmé, že takto evoluce (makroevoluce) nefungovala. V principu tedy genetické algoritmy žádnou skutečnou historickou evoluci nenapodobují, ale napodobují předpokládaný či lépe řečeno lidmi vymyšlený vývoj.

Závěr

Informace je nehmotná, nevzniká z něčeho hmotného. Pro její identifikaci námi lidmi musí být zaznamenána. Tento záznam už hmotný je. Už samovolný vznik jednoduché instrukce (např. příkazu „jdi tam a tam“) je nesmysl. Natož přesné a správné uspořádání instrukcí do algoritmu a přesné a správné uspořádání algoritmů do programu. Také kódování, překlad a přesné uložení jednotlivých instrukcí, jakož algoritmů v programu. Nemůže samovolně vzniknout nějakými kombinacemi hmoty. A ani průběhem fyzikálních podmínek (teploty, tlaku či intenzity záření).

Pominul jsem vznik a vývoj nepohlavně se reprodukujících organismů, u nichž žádné křížení nenastává. A samozřejmě jejich údajnou přeměnu na párující se organismy. Tady už vůbec nelze aplikovat výše uvedené genetické algoritmy.

Život nevznikl a neměnil se náhodně a působením či vlivem podmínek, ale byl vytvořen Tvůrcem. To už jenom proto, že od nejjednodušších organismů obsahuje instrukce, nehmotné entity.

Share on FacebookShare on Google+Tweet about this on TwitterShare on LinkedInEmail this to someonePrint this page

Komentujte

199 Komentáře zapnuto "Mohl by nějaký algoritmus vzniknout samovolně (spontánně) bez působení inteligentní osoby?"

Upozornit na
Foton
Foton

Len nie normálny človek dokáže uveriť tomu, že od roku 1988 vyhrávam jackpot športky pri každom losovaní až do dnes. A evolucionista nie je normálny človek, to mi ver. 😀

Delace je zásadní změna, ale ne kreativní zásadní změna. 😉

SSK
SSK

Malá pravděpodobnost není nemožnost. To mi stačí. A ta delece půlky teda je nebo není zásadní změna?

Foton
Foton

To je pravda, že nelze. Pravdepodobnosť 1:10^300 je tiež pravdepodobnosť. 😀 Vieš akéje najväčšie číslo pre evolucionistu? Takéto: 1,44×10^119

Chýbať môže. To sa dá pochopiť.

SSK
SSK

Ale náhodnou změnu z třeba z proteinu 1) na 2) přece vyloučit nelze, ne?
Ještě by mě zajímalo, zda je chybějící půlka proteinu zásadní změna?

Foton
Foton

Náhodná zásadná zmena funkciu vždy naruší. Cielená programátorom nie.

SSK
SSK

Ptám se znovu: Musí i zásadní změna nutně narušit funkci?

Foton
Foton

To z toho vôbec nevyplýva. Musíš vedieť programovať. To je celé. A k tomu potrebuješ inteligenntého programátora. Bez neho nezískaš gény so zásadne odlišným usporiadaním nukleobáz a rovnakou funkciou. Práve tá rozdielnosť usporiadania nukleobáz je silným dôkazom proti evolúcii…

SSK
SSK

Takže ani zásadní změna nemusí nutně funkci narušit?

Foton
Foton

Áno, je to možné. To som nikdy nepopieral. Ako programátor viem, že program na jeden účel sa dá naprogramovať 1000 rôznymi spôsobmi. Som špecialista predovšetkým v PIC a SIMATIC. Viem, ako sa dá jedna a tá istá vec naprogramovať rôznymi spôsobmi. Inak tomu nebude ani v bunkách…

SSK
SSK

Nejsou? Takže je možné, aby protein vypadal zásadně jinak a přitom plnil stále tutéž funkci?

Foton
Foton

Mimochodem, níže uvádím primární sekvence čtyř proteinů. Každý z těch proteinů má v každém z těch organismů tutéž funkci. Podle tebe by měly být úplně nebo téměř stejné. Jsou?

Nejsou. A není ani zapotřebí. Dôležité je, že fungujú ako ich v každom tom prípade stvoriteľ naprogramoval.

SSK
SSK

Fotone, co ty čtyři proteiny, jsou stejné nebo se nějak liší? Pokud ano, jak moc? Je to zásadně?

Foton
Foton

Tím, že si klidně může produkovat funkční, nefunkční i žádný protein, aniž by to negativně ovlivňovalo fitness. Víc nemám, co bych dodal.

Lenže bez proteosyntézy nezistíš, či je funkční, nefunkční. A keď proteosyntéza nastane, môže mať zdrvujúce účinky na organizmus. Je to rovnaké, ako keby syntetizoval poškodený originál…

Foton
Foton

Může nebo nemusí. Protože je to duplikát, tak může klidně mutovat, někdy neprodukovat protein, jindy ano.

Lenže aby si si overil, či tie mutácie aj k čmusi boli, musíš syntetizovať. Alebo nie?

Pokud ale po nějaké době vznikne mutacemi protein, který má využitelnou funkci, začne působit selekce.

Ako môže mutáciami vzniknúť proteín z využiteľnou funkciou bez spätnej kontroly? Ako zistíš, že už sa dá využiť? Bez proteosyntézy a vystaveniu daného organizmu prostrediu asi nie, nemyslíš?

SSK
SSK
Ale stále máš iba viac či menej rhodopsín. To, čo je už ďaleko od tejto štruktúry nefunguje a prirodzený výber tomu spraví kill. Čiže žiadny zásadne odlišný proteín touto cestou nezískaš. Vždy len veci blížiace sa rhodopsínu. Tak to není. Záleží na tom, pod jakým selekčním tlakem ten gen je. Ukáž aspoň jeden praktický príklad, ako sa evolučnou alebo laboratórnou cestou podarilo premeniť jeden proteín v iný, ktorého usporiadanie AK je zásadne odlišné – a má nejakú funkciu. Nevím proč. Pro argument, kdy jsem se odkazoval na proteinové inženýrství, to… Číst vice »
Foton
Foton

Když budeš žít v jeskyni, kde je pořád tma, tak funkční rhodopsin vůbec nepotřebuješ. Dokonce ani oči. Kdyby to bylo, jak ty tvrdíš, tak už tady všechno dávno vyhynulo, což se evidentně nestalo.

Áno, môže sa vypnúť alebo poškodiť, že už nebude schopný proteosyntézy. Vypínanie, zapínanie a kazenie génov pozorujeme. To, čo sme nikdy nikde nepozorovali je, aby z toho vznikol počase iný gén pre úplne iný proteín.

Foton
Foton
Pokud fungují mutace, tak máš vždy z čeho vybírat, protože ti, co se rozmnožili museli fungovat. Jde jenom o to, jak silný je selekční tlak na zachování aktuální funkce. To je celé. Ale stále máš iba viac či menej rhodopsín. To, čo je už ďaleko od tejto štruktúry nefunguje a prirodzený výber tomu spraví kill. Čiže žiadny zásadne odlišný proteín touto cestou nezískaš. Vždy len veci blížiace sa rhodopsínu. Ale u mnoha jiných to naprosto neplatí nebo se to často mění. Ukáž aspoň jeden praktický príklad, ako sa evolučnou alebo… Číst vice »
SSK
SSK

Čiže duplikát génu musí najskôr vyprodukovať proteín, aby sme vedeli, či aj k čomusi budú zmeny na ňom vykonané.

Může nebo nemusí. Protože je to duplikát, tak může klidně mutovat, někdy neprodukovat protein, jindy ano. Nic na něj netlačí. Pokud ale po nějaké době vznikne mutacemi protein, který má využitelnou funkci, začne působit selekce.

Čím sa potom líši taký scénar od proteosyntézy na originále?

Tím, že si klidně může produkovat funkční, nefunkční i žádný protein, aniž by to negativně ovlivňovalo fitness. Víc nemám, co bych dodal.

Foton
Foton

Aha. Špatně jsem ten tvůj dotaz pochopil.

U teba nič neobvyklé. A potom svoje nepochopenie premietaš na oponentove špatné vyjadrovanie.

Tím „něco dělá“ jsem myslel kóduje protein, když jsme se bavili o proteinech.

Nie. Tu sa bavíme o význame duplikátu v procese evolúcie. (Nie, nepodarí sa ti vytvoriť hmlu, ako obvykle.) 😉 -Čiže duplikát génu musí najskôr vyprodukovať proteín, aby sme vedeli, či aj k čomusi budú zmeny na ňom vykonané. Čím sa potom líši taký scénar od proteosyntézy na originále?

SSK
SSK

Mimochodem, níže uvádím primární sekvence čtyř proteinů. Každý z těch proteinů má v každém z těch organismů tutéž funkci. Podle tebe by měly být úplně nebo téměř stejné. Jsou?

1)
MADDTPIIEEIAEQNESVTRIMQRLKHDMQRVTSVPGFNTSAAGVNDLIDILNQYKKELEDDAANDYTEA
HIHKIRLVTGKRNQYVLKLKQAEDEYHARKEQARRRASSMDFTVGRNSTNLVDYSHGRHHMPSYRRHDSS
DEENYSMDGTNGDGNRAGPSNPDRGNRTGPSSSDRVRMRAGRNRVTKTRRYRPGQKALEEIRKYQKTEDL
LIQKAPFARLVREIMQTSTPFGADCRIRSDAISALQEAAEAFLVEMFEGSSLISTHAKRVTLMTTDIQLY
RRLCLRHL

2)
MGPRRRSRKPEAPRRRSPSPTPTPGPSRRGPSLGASSHQHSRRRQGWLKEIRKLQKSTHLLIRKLPFSRL
AREICVKFTRGVDFNWQAQALLALQEAAEAFLVHLFEDAYLLTLHAGRVTLFPKDVQLARRIRGLEEGLG

3)
MPRHSRAKRAPRPSANNSKSPNDDDTAFRSPEPEDGTDYGLEFTTSQLTLQDNNRRSSTLRRDAGRRQPA
ARDSSTSGEEEDQENRYPTTRSPQTRRMTVQQESKTRAAGPVAAQNQTRRRKAANPMSRAKRMDREIRRL
QHHPGTLIPKLPFSRLVREFIVKYSDDEPLRVTEGALLAMQESCEMYLTQRLADSYMLTKHRNRVTLEVR
DMALMAYICDRGRQF

4)
MARTKHRVTRSQPRNQTDAAGASSSQAAGPTTTPTRRGGEGGDNTQQTNPTTSPATGTRRGAKRSRQAMP
RGSQKKSYRYRPGTVALKEIRHFQKQTNLLIPAASFIREVRSITHMLAPPQINRWTAEALVALQEAAEDY
LVGLFSDSMLCAIHARRVTLMRKDFELARRLGGKGRPW

SSK
SSK
Ako uvidíš „zda něco dělá a co to je“ bez proteosyntézy? Aha. Špatně jsem ten tvůj dotaz pochopil. Tím „něco dělá“ jsem myslel kóduje protein, když jsme se bavili o proteinech. Preto od určitého bodu už nemáš čo vyberať (okrem takých usporiadaní, ktoré sú viac alebo menej rhodopsín.) Pokud fungují mutace, tak máš vždy z čeho vybírat, protože ti, co se rozmnožili museli fungovat. Jde jenom o to, jak silný je selekční tlak na zachování aktuální funkce. To je celé. Ty v podstatě tvrdíš, že je za všech okolností tak… Číst vice »
Foton
Foton
Říkám zda a co to je. Komédia. 😛 Ty už si v koncoch, keď sa takto vyhýbaš odpovedi. Teda opakujem otázku aj s tvojim zda: 😛 Ako uvidíš „zda něco dělá a co to je“ bez proteosyntézy? (…som zvedavý, akú výhovorku si vymyslíš teraz…) Jak jsi na to přišel? Pretože rhodopsín plní svoju funkciu len vtedy, keď funguje. A to je dané zapojením súčiastok – v tomto prípade aminokyselín. Náhodné zmeny kazia zapojenie a znehodnocujú funkčnosť. Preto od určitého bodu už nemáš čo vyberať (okrem takých usporiadaní, ktoré sú viac… Číst vice »
SSK
SSK
Ako uvidíš „co dělá“ a „co to je“ bez proteosyntézy? Říkám zda a co to je. Krom toho geny nekódují jenom proteiny, takže ani v tomto smyslu není proteosyntéza nutná. Ale po väčších zmenách nasleduje nefunkčnosť Jak jsi na to přišel? Ty tohle stále jenom tvrdíš, ale neumíš to dokázat. Opakuji znovu: nefunkční zmetky odstraní selekce, (pokud ta nefunkčnost vadí, což nemusí platit). Nevím, jak jinak už to mám napsat, abys to pochopil. Pracuje se s populací, v té se mutacemi generuje variabilita, ale žádná povinnost mutovat neexistuje, takže v… Číst vice »
Foton
Foton

SSK

Vidím, že v genomu je ten gen dvakrát. A vidím, zda něco dělá a co to je.

Ako uvidíš „co dělá“ a „co to je“ bez proteosyntézy?

Náhodné změny ano. Náhodné změny spojené s reprodukcí a selekcí ne.

Vyberať môžeš len z toho, čoho sú zmeny schopné. Trochu upraviť funkciu rhodopsínu, ale stále je to rhodopsín. Poprípade vznikne nejaká porucha rhodopsínu – čiže správanie, aké dovtedy nemal. Ale stále je to viac menej rhodopsín. Z toho sa ešte dá vyberať. Ale po väčších zmenách nasleduje nefunkčnosť. Z nefunkčných vecí sa dá ako vyberať?

Foton
Foton
Ty nesmyslné znaky vlastně nesmyslné být nemusejí. Záleží na aktuálním kontextu. Inak cením si, že ako jeden z mála evolucionistov hľadáš význam aj tam, kde by iný povedal, že je to len evolučný balast. 😉 Pokud dojde k posunové mutaci v genu pro nějaký protein, tak se to taky automaticky neřeší tím, že se to vystřihne jako intron. Posunová mutace klidně může vést k nové funkci nebo tu původní nemusí narušit. Samozrejme nemám problém s tým, že gény sú viacúčelovo naprogramované. Napr. posun môže prepnúť jeho význam. To, čo boli… Číst vice »
SSK
SSK

A ako sa o tom duplikáte dozvieš bez proteosyntézy, že jeho význam/funkcia už pokročil? (Vidíš, akým nezmyslom veríš.)

Vidím, že v genomu je ten gen dvakrát. A vidím, zda něco dělá a co to je.

Proste náhodné zmeny napr na rhodopsíne povedú skôr či neskôr k deštrukcii,

Náhodné změny ano. Náhodné změny spojené s reprodukcí a selekcí ne.

Foton
Foton
Ani nemůže. Je to proste blud. (Nepomôže ti ani slovíčkariť.) -Občas sa stáva podobne ako pri vetách, že zámena znaku zmení význam vety na iný. Napr veta „Cirkusový lev jedol z ruky krotiteľa.“ je toho príkladom. Ale k inej vete so zásadne odlišným usporiadaním písmen sa tým nedostaneš. Bolo ti to tu už viac krát oznámené. Preto je lepšie hovoriť radšej o proteínoch, aby sme sa vyhli vašim výhovorkým na tiché mutácie. …A ako sa o tom duplikáte dozvieš bez proteosyntézy, že jeho význam/funkcia už pokročil? (Vidíš, akým nezmyslom veríš.)… Číst vice »
SSK
SSK
Nie je pravda, že takmer každá náhodná mutácia vedie k nejakej funkcii. To je proste lož a na lžiach nebudeme predsa stavať analógie. Nepřekrucuj má slova. Psal jsem, že téměř každá náhodná a libovolně rozsáhlá mutace genu může vést k funkčnímu proteinu. Ten protein může fungovat stejně nebo jinak. Každopádně je to fakt, o němž s tebou prostě nebudu diskutovat. Důvody už ti tu opakovaně vysvětloval tuším George. Nakoľko výsledkom náhodných zmien sú poruchy a nezmysly, čo chceš z nezmyslov vyselektovať? To je zase to tvoje binární (jak příznačné) vidění.… Číst vice »
Foton
Foton

Nie je pravda, že takmer každá náhodná mutácia vedie k nejakej funkcii. To je proste lož a na lžiach nebudeme predsa stavať analógie.

Nakoľko výsledkom náhodných zmien sú poruchy a nezmysly, čo chceš z nezmyslov vyselektovať?

Sami o sebe nemajú zmysel. Ale zapojené v obvode (vs. v proteíne) zmysel a účel plnia. Nie, nepodarí sa ti z toho vykrútiť.

SSK
SSK

To je ten nezmysel, ktorému vy evolucionisti veríte.

Nebudu ti to vyvracet. Ale uvědomuješ si, že tím, že toto odmítáš, tak vlastně přiznáváš falešnost své analogie?

Vždy sa však jedná o poruchu, ktorých hromadením sa systém postupne znefunkční.

Ale od toho je tu přece selekce. Kdyby byly mutace ve všech jedincích v populaci stejné a/nebo by nefungovalo rozmnožování, tak bys měl pravdu.

Každá elektronická súčiastka má podobne ako aminokyselina svoj zmysel a účel.

Aminokyseliny nemají smysl ani účel.

Foton
Foton

Dám ti teda lepšiu analógiu. Elektronické obvody. Každá elektronická súčiastka má podobne ako aminokyselina svoj zmysel a účel. Skúsme náhodnými zmenami vytvoriť nejaké zariadenie.

Foton
Foton

Problém je, že téměř každá náhodná a libovolně rozsáhlá mutace genu může vést k funkčnímu proteinu.

To je ten nezmysel, ktorému vy evolucionisti veríte.

Jenže už neplatí, že důsledky mutací genů a vět, tak jak je prezentuješ, jsou stejné.

V každom inom systéme náhodná zmena vyvolá iné dôsledky, charakteristické pre daný systém. Vždy sa však jedná o poruchu, ktorých hromadením sa systém postupne znefunkční.

SSK
SSK

Vety fungujú tak, ako fungujú. Gény používajú zas niečo iné. To, čo majú spoločné (a na čo sa zameriavam) je informácia uložená v špecifickom usporiadaní jednotiek systému.

Ale jo, na tom se shodneme. Jenže už neplatí, že důsledky mutací genů a vět, tak jak je prezentuješ, jsou stejné. A v tom je zakopaný pes. Problém je, že téměř každá náhodná a libovolně rozsáhlá mutace genu může vést k funkčnímu proteinu. Platí totéž o větě? Ty tvrdíš, že ne. A tady tvoje analogie selhává.

Foton
Foton

Čiže analógia to nie je falošná, pretože spoločným znakom o ktorý v analógii ide, je vznik zmysluplnej informácie. Cieľom nie je a nikdy nebolo kopírovať činnosť génov. …Podobne mechanický počítač sa svojou činnosťou veľmi líši od elektronického. Napriek tomu sa dá v istých aspektoch použiť, ako analógia k elektronickému.

Foton
Foton

SSK
Nie. To ty si majster nepochopenia a vyrábania z komára somára. Vety fungujú tak, ako fungujú. Gény používajú zas niečo iné. To, čo majú spoločné (a na čo sa zameriavam) je informácia uložená v špecifickom usporiadaní jednotiek systému. Nad týmto vždy statočne zatváraš oči, lebo inak by si musel priznať, že napr rhodopsín sa ku svojmu usporiadaniu nemohol dopracovať náhodnými zmenami a výberom z výsledkov náhod.

SSK
SSK

Ale houby. Ty jsi mistr falešných analogií, z čehož jsi tu byl opakovaně usvědčen (vlastně asi vždycky, když jsi zkoušel něco vyvracet s použitím analogie). Takže jsi vlastně břídil, který není schopen své falešné analogie dostatečně dobře maskovat. A tím, že budeš tvrdit, že zásadní nedostatky v tvých falešných analogiích jsou nepodstatné detaily, z nich skutečné analogie neuděláš.

Foton
Foton

SSK
Od analógie sa nečaká izomorfizmus. Ty chceš, aby som svoju analógiu prerobil na izomorfizmus, dovtedy je podľa teba falošná. Problém je, že ty nevieš, čo je to analógia. Analógie sa vo vede bežne používajú. Dal som ti teda lepšiu analógiu, len ešte čaká ten príspevok na schválenie, lebo sú v ňom 2 odkazy.

SSK
SSK

Nezmyselné slová môžeš ignorovať. (Analógia zostrihu intronov na pre-mRNA, čím vznikne mRNA pripravená na proteosyntézu.)

Ale tak to právě není. Ty nesmyslné znaky vlastně nesmyslné být nemusejí. Záleží na aktuálním kontextu. Pokud dojde k posunové mutaci v genu pro nějaký protein, tak se to taky automaticky neřeší tím, že se to vystřihne jako intron. Posunová mutace klidně může vést k nové funkci nebo tu původní nemusí narušit.

Foton
Foton

SSK

Aby tvoje analogie s větami nebyla falešná, musela by být analogií bází slova a ne písmena.

Báza nemá taký význam, ako slovo. Ale dám ti lepšiu analógiu keď chceš: Náhodný reťazec núl a jedničiek, ktorý nahráš do pamäti programu napr. obvodu PIC16F1936.

Foton
Foton

George

Tak, ako gény majú stop triplety, vety majú zas zakončovacie znaky: .!?

Nezmyselné slová môžeš ignorovať. (Analógia zostrihu intronov na pre-mRNA, čím vznikne mRNA pripravená na proteosyntézu.)

George
George
Tak to zkusme takhle. Hned ten prvni priklad s inzerci nam ukazuje dva problemy. The bad cat saw the big dog and ran and bit him VS. The bad cat sai nse rte ddn awt heb igd oga ndr ana ndb ith im Dostaneme hned celou radu slov, ktera nedavaji zadny smysl. Ale kdybychom o nich chteli uvazovat jako o STOP kodonech, tak ty jsou obvykle 3. Dale, to ze dojde k predcasnemu ukonceni translace automaticky neznamena, ze zkraceny protein bude nefunkcni. To by na urovni vet bylo zapotrebi zohlednit… Číst vice »
Foton
Foton

Aminokyseliny pochopiteľne nie sú slová, pretože aminokyselina nemá taký význam, ako slovo.

Foton
Foton

Rôzne informačné systémy majú svoje špecifiká a sémantiku. Elektronické obvody majú elektronické súčiastky. Počítačové programy majú logické stavy zaznamenané na určitom médiu – predpis práce pre procesor. Vety používajú písmená abecedy ako predpis významu pre človeka. Gény používajú nukleobázy k zaznamenaniu postupu proteosyntézy, kde výsedný proteín más svoj účel a funkciu. To, čo majú všetci spoločné, je špecifická funkčná účelná informácia.Toto tx ,sko evolucionista odmietaš priznať, pretože si zaslepený svojou báchorkou.

SSK-neprihlaseny
SSK-neprihlaseny

Foton

Aby tvoje analogie s větami nebyla falešná, musela by být analogií bází slova a ne písmena. To ale asi nikdy nepochopíš, protože nesmíš. Nebo to víš, ale ze zjevných důvodů musíš trvat na své falešné analogii.

Foton
Foton

Ty řetězce z populace řetězců, které se budou dané větě blížit nejvíc, budou vybrány do další generace, kde se opět bude mutovat.

V prírode neexistuje žiadna predloha génu, podľa ktorej by nejaký algoritmus porovnával, či sa mu už blíži – a podľa toho vyberal. Jediné, čo rozhoduje, je hlavne funkčnosť a potom funkcia. Toto čo si napísal je práve to v čom vy evolucionisti klamete.

To, co selektuje v přírodě jsou vnější faktory (biotické i abiotické), ne vlastnost organismu.

Uveď praktické príklady ty luhár!

SSK-neprihlaseny
SSK-neprihlaseny

Foton
Žádné aspoň takého. Ty řetězce z populace řetězců, které se budou dané větě blížit nejvíc, budou vybrány do další generace, kde se opět bude mutovat. A tak pořád dokola, dokud se nedojde k dané větě. Tohle ty samozřejmě odmítneš. Ale tak funguje evoluce náhodnými mutacemi a selekcí. To, co selektuje v přírodě jsou vnější faktory (biotické i abiotické), ne vlastnost organismu. Když chceš toto simulovat v počítači, tak ten vnější faktor, musíš nastavit ty. V tomto případě konkrétní řetězec znaků. O zbytek se postará evoluční algoritmus.

Foton
Foton

SSK
Jediné, čo ju zbúra je, keď sa ku takým vetám dopracuješ náhodnými zmenami a výberom podľa významu (aspoň takého, ako si načrtol), nie tvoje kecy a opakované výhovorky. Vidíš, nepomohlo ti cediť komára. 😉

Václav Dostál
Václav Dostál

Doporučuji zařadit poslední příspěvek pana SSK (o vztahu jedinec-populace) do „perliček“

SSK
SSK

Václav Dostál

„Jedinec/gen je jednotkou selekce. Nikoli populace.“

Ano, to jsem napsal. Škoda, že naprosto nejste schopen vysvětlit, jak tento můj pravdivý výrok kontrastuje s tímto: „populace = soubor jedinců téhož druhu žijící na určitém stanovišti v určitém čase, jedinci geneticky příbuzní, schopní se vzájemně plodně křížit (tj. mít plodné potomstvo).

Václav Dostál
Václav Dostál

Všem kromě SSK
SSK 29.5.2017 10:59 ve druhé větě napsal:
„Jedinec/gen je jednotkou selekce. Nikoli populace.“
Už v té diskusi, z níž je tento úryvek, jsem se pana SSK ptal JAK to tedy vlastně je. Neráčil odpovědět.
Další fakta lze najít ne tak „daleko“ jeko tento.

SSK
SSK
Václav Dostál Uvedená rovnováha/rovnice NENÍ jednou ze základních částí ET?? Ne. Své rozporné tvrzení si najděte sám. Uvedl jsem odkaz. To půjde těžko, když jsem nic, co je v rozporu s tím textem, nenapsal. Vy tvrdíte, vy doložte. Nebo nelžete. 3. Nepsal jsem o nulovosti genetického driftu a ale o VLIVU tototo driftu. Však to jsem měl na mysli. Možná jsem se nevyjádřil úplně dobře. Vliv genetického driftu nemůže být nulový ze samotné podstaty genetického driftu. Vynechal jste důležitou část mého souvětí o selekci se záporným vlivem. Tak prosím: A… Číst vice »
Václav Dostál
Václav Dostál

Pro SSK
1. Uvedená rovnováha/rovnice NENÍ jednou ze základních částí ET??
2. Své rozporné tvrzení si najděte sám. Uvedl jsem odkaz.
3. Nepsal jsem o nulovosti genetického driftu a ale o VLIVU tototo driftu.
4: Vynechal jste důležitou část mého souvětí o selekci se záporným vlivem.
Tyto 4 body POTVRZUJÍ mé rozhodnutí nediskutovat s Vámi o algoritmech a ZVYŠUJÍ rozšíření tohoto rozhodnutí i na jiná témata. Takže nadále se Vámi bavit nebudu O NIČEM.

SSK
SSK
Václav Dostál Víte vy vůbec, co znamená termín „model“ a jak se ve vědě modely používají? Přitom je uvedená rovnováha a rovnice jednou ze základních částí evoluční teorie!! Jak jste na tenhle nesmysl přišel? populace = soubor jedinců téhož druhu žijící na určitém stanovišti v určitém čase, jedinci geneticky příbuzní, schopní se vzájemně plodně křížit (tj. mít plodné potomstvo).“ To kontrastuje s tvrzením pana SSK S jakým mým tvrzením to kontrastuje? Uvedení evoluční biologové se budou přít, zda je význam tohoto driftu velký nebo malý, ale asi nepřipustí, že by… Číst vice »
SSK

Foton

Jaképak nepodstatné chyby? Vždyť to, že ty věty mají smysl, což sám uznáváš, zcela bortí tvá východiska a celou tvou předchozí argumentaci. Budeš si muset zvyknout na to, že tvůj styl komunikace a argumentace, který možná zdejším kreacionistům imponuje, protože vypadá sofistikovaně a odborně, stojí na trouchnivých nožičkách. Jsou to právě ty detaily, které jasně ukazují, že meleš naprosté kraviny.

Václav Dostál
Václav Dostál

Evoluční teorie sama proti sobě
Při diskusi o algoritmech mi byl doporučen text „Review of Population Genetics Equations“ (http://www.radford.edu/~rsheehy/Gen_flash/ABLE_Workshop/Popgen_Equations.pdf). Text se mi jevil těžkopádným a tak vybírám také jiné texty s podobnými kapitolami. První kapitola se místo „Hardy-Weibregova rovnice“ nazývá „Hardy-Weinbergova rovnováha“.
Více na: http://vaclavdostal.8u.cz/et_rozporna.htm

Foton
Foton

SSK
Veď kiež by si získal náhodnými zmenami aspoň také. Nie. Ty sa radšej budeš vykrúcať – a ako to vždy robíš hľadať v oponentových reakciách nepodstatné chyby, aby si sa poukazovaním na ne vykrútil z diskusie, kde od teba požadujú relevantné dôkazy.

SSK

Fotone, já jsem nedostal nic. Ty věty, které jsem zminoval jsou srozumitelné bez ohledu na to, co tvrdíš.

Foton
Foton

SSK
Vidím, že ideológia pracuje. Skús si ten reťazec vložiť do google, čo ti vyhodí. …Napriek tomu som však spravil ústupok a umožnil ignorovať nezmyselné znaky medzi vzniknutými slovami v náhodnom reťazci. Hlavne nekecaj a mutuj. Reťazec si už dostal.

SSK

Podstata viet spočíva v tom, že ak sa v nej vyskytujú rušivé elementy, význam už mať nebude.

Tohle není pravda. Ty ale z toho musíš vycházet, protože by ti to jinak nevyšlo. Věta „„Ph0tonN3umiPr0gr4m0vat“ má význam a je srozumitelná i když je plná rušivých elementů. Stejně tak věta „Ph0tton_N3xm1Pr0Gr4mov4TT“.

Foton
Foton
George 2: Tzn. ve vete by se prubezne mohla vyskytovat i slova (mutovana), ktera by byla nesmyslna, aniz by to necemu vadilo. Podstata viet spočíva v tom, že ak sa v nej vyskytujú rušivé elementy, význam už mať nebude. Ale môžem spraviť v tejto veci s tebou kompromis. Keď napr do vety „„Cirkusový lev jedol z ruky krotiteľa.““ vložíme nezmyselné znaky, bude z toho napr. „„Cirkusový uvknrux lev wcosa jedol z jijj ruky Vbugua krotiteľa.““ Význam to síce už nemá, ale dohodnime sa na poľahčujúcom algoritme, že keď sa teda… Číst vice »
Foton
Foton
George Netrvám na tom, aby reťazec znakov ako celok musel mať význam. Napr. veta: „Cirkusový lev jedol z ruky krotiteľa.“ môže byť kľudne obklopená balastom. Dôležité je, že v reťazci sa vyskytla táto veta. A má svoj význam. Tak, ako lyzín má vlastnosti z ktorých plynú nejaké dôsledky, aj povedzme písmeno „a“ má vo vo vete svoj význam, z ktorého plynú určité dôsledky. Význam vety je prirovnaný k funkcii génu. To, čo majú analogicky spoločné, je účelná informácia o ktorej je reč. Analógia je skutočnosť, že medzi dvoma alebo viacerými… Číst vice »
Foton
Foton
Chápem, že svoju neschopnosť a do veľkej miery i neznalosť potrebuješ ventilovať osočovaním oponenta (bez toho by jeden evolucionista nemohol byť), ale pokiaľ by si vedel aspoň čítať, dozvedel by si sa, že celkový počet populácie vrátane počet rozmnožernín som už ponechal na teba. (Aby si sa nemal na čo vyhovárať. Lebo to vy evolucionisti, keď ste v koncoch s argumentami radi robíte. Zameriate sa na podružnosti.). …V tom druhom reťazci ktorý si uviedol sa nachádzajú úseky, ktoré majú význam. Kazí to tam tá trojka, ktorú musíš najprv vystrihnuť. Dovtedy… Číst vice »
George
George
Foton: samozrejme by to slo demonstrovat na vetach lepe nez ted, pokud bys ovsem nesmyslne neztotoznoval funkci se srozumitelnosti cele vety. Tzn. ve vete by se prubezne mohla vyskytovat i slova (mutovana), ktera by byla nesmyslna, aniz by to necemu vadilo. Pak by to ovsem zase nevychazelo tobe, jak ty potrebujes (ostatne i proto ses myslim sveho casu dohadoval o definici nesmyslne mutace). Takhle co do te „dramaticnosti“ porovnavas uplne neporovnatelne veci. Protoze napriklad ten lysin ma urcite vlastnosti a z tech urcitych vlastnosti pak dale plynou nejake dusledky a… Číst vice »
koroslav
koroslav
Popíš v čom je blbě. Plakať dokáže každý. No jeden by zaplakal nad tvojí hloupostí. Fitness funkce, která má vždy minimálně 10% populace se stejnou fitness, je k ničemu. Funkce, která má počet návratových hordnot spočitatelný na prstech jedné ruky je k smíchu, protžoe neumožňuje objektivně porovnávat jednotlivé objekty. Pokud maji retezce „kjabfjhabfkjdvckhgvh“ a „Ph0tonN3umiPr0gr4m0vat“ stejnou fitness (což podle tvého „algoritmu“ mají), je takovýá funkce k ničemu. Pokud tohle nechápeš, asi už se nemáme o čem bavit. Odpovedal som ti „Predveď to.“ A já Ti říkám, že to rád předvedu,… Číst vice »
Foton
Foton

oprava: …na „nesmrteľnosť“.

Foton
Foton

George
Pozri: v prípade buniek dokážeš jedinou zmenou premeniť „obyčajnosť“ na „smrteľnosť“. Podobné dramatické zmeny významu však dokážeš robiť aj pri vetách – a to tiež len zmenou jediného znaku (…i keď nie zrovna konkrétne v prípade „bežný“ vs. „smrteľný“, dajú sa nájsť iné, analogicky podobné premeny významu jedinou zmenou).

George
George
K tvojmu sklamaniu také veci dokážu aj vety. Nedokazou. Aby to opravdu odpovidalo, muselo by to byt napriklad takto: mejme vetu „Ja jsem obycejna bunka“ a provedme mutaci na jedne pozici, takze dostaneme vetu „Ja jsem obycejna banka“. Ta druha veta by vsak mela mit vyznam „Ja jsem nesmrtelna bunka“ (ted trochu zkracuju, mam na mysli mitotickou nesmrtelnost). Protoze nas zajima zmena funkce, vlastnosti – a z tohoto hlediska neni vubec podstatne, zda jde o dusledek jedne mutace nebo vice mutaci. V pripade vet bys toho musel zmenit mnohem vic,… Číst vice »
Foton
Foton

SSK
Ako keby vety nedokázali to isté… Ale chápem, že treba raz za čas oprášiť aj staršie argumentačné klamy – v tomto prípade klam dány vylúčením.

SSK

George

Takovych priklad se da najit XY a je to naprosto nesrovnatelne s vetami, kde proste zmena jednoho pismenka ze 136 nic podobneho nedokaze, protoze to zkratka nejde. Porad dokola…

Foton ale musí trvat na falešné analogii s větou, protože jinak by mu to nevycházelo, jak on potřebuje.

Foton
Foton
George Prestoze jsme provedli pouze zmenu jednoho jedineho znaku z celkem 136, celkova funkce se vyrazne zmeni a bunka ziska schopnosti, ktere do te doby nemela Keby si vedel čítať zistil by si, že o tom som už dávno písal – a to nie len v súvislosti s mojou analógiou. Také veci sú pochopiteľné z tam popísaných dôvodov aj s príkladom. Dôležité je, že týmto nevytvoríš postupnosť, ako sa dostať ku génu/proteínu so zásadne odlišným usporiadaním aminokyselín a funkciou. (A pozorované rozdiely sú obrovské) Takovych priklad se da najit XY… Číst vice »
George
George
Našim cieľom je však veta aspoň 100 znaková so zmyslom a použiteľným významom. Mejme gen H3F3A, jehoz velikost cini 136 aminokyselin. Provedme jednu jedinou mutaci a to substituci methioninu za lysin na pozici 27. Prestoze jsme provedli pouze zmenu jednoho jedineho znaku z celkem 136, celkova funkce se vyrazne zmeni a bunka ziska schopnosti, ktere do te doby nemela (v tomto konkretnim pripade bohuzel). Duvody se mi ted nechteji rozepisovat. Takovych priklad se da najit XY a je to naprosto nesrovnatelne s vetami, kde proste zmena jednoho pismenka ze 136… Číst vice »
George
George

Foton: co napr.? Vubec nechapu co zase chces resit na zcela evidentni veci. Zcela evidentni je, ze ja napsal jen a pouze toto: Viz heslo „konzervativni nekodujici sekvence“. Nic vic a nic min. Vsechno ostatni, na co jsi nasledne „reagoval“, sis k tomu proste a krasne pribasnil. Nikde nepisu, ze to ze je nejaka sekvence nekodujici znamena, ze nema zadny vyznam, takze je naprosto zbytecne mi to oznamovat. Atd.

Foton
Foton

George
Napr.?

George
George

Foton: V čom som mimo?

Ve vsem co jsi v ramci te reakce napsal. Reagujes totiz na neco, co jsem nikde neuvadel.

Foton
Foton
Koroslav Ešte k tomu poslednému bodu. Ak chceš, prenesme sa kľudne do sveta výpočtovej techniky a skúsme náhodne zostrojiť nejaký program. Podobne, ako najmenšou jednotkou informácie DNA programu je nukleobáza (s ktorými sa mutuje), najmenšou jednotkou PC programu je bit. Preto mutujme s bitmi a vyberajme použiteľné dátové sekvencie. Postup bude identický ako pri analógii s vetami: START Majme reťazec 1000 náhodných núl a jedničiek. 1. Náhodne vylosuj pozíciu od 1 do 1000. 2. Náhodne vylosuj akciu: inzercia, delácia alebo substitúcia. 3. Ak bola v kroku 2 vylosovaná inzercia alebo… Číst vice »
Foton
Foton
Jenom se snažíš kličkovat. Ty si tvrdil, že „Pokud začneme s řetězcem 100 náhodných znaků f(V) = funkční hodnota věty V bude vysoká. Evoluční algoritmus aplikovaný na takovouto náhodnou větu by poměrně rychle konvergoval do nějaké smysluplné věty.“ Odpovedal som ti „Predveď to.“ (Takže neviem, kto tu kľučkuje.) Ale faktem je že TY jsi se snažil pomocí této falešné analogie něco vyvrátit. Takže to budeš TY, kdo funkci naprogramuje. Tak nekecej a programuj, když jsi takový génius. Nie, nie som génius. Len používam zdravý rozum. Ja sa nesnažím obhajovať neobhájiteľné… Číst vice »
koroslav
koroslav

Jenom se snažíš kličkovat. Ale faktem je že TY jsi se snažil pomocí této falešné analogie něco vyvrátit. Takže to budeš TY, kdo funkci naprogramuje. Tak nekecej a programuj, když jsi takový génius.
Já Ti jenom říkám, že design sis udělal blbě, tak nečekej, že až to podle toho naprogramuješ, že to bude fungovat.

Jo a jsem fakt zvědavý, jak poznáš veta s významom Těším se, až mi předvedeš, jak to naimplementovat.

Foton
Foton
Slušný programátor deklaruje To nie je o slušnosti. fitness funkce by měla vrátit buď hodnotu nebo aspoň pořadí. To som písal všeobecne, lebo veta: „Funkce začíná deklarací, definicí a končí návratovou hodnotou.“ na ktorú som reagoval bola tiež všeobecná. fitness funkce by měla vrátit buď hodnotu nebo aspoň pořadí. Áno, môžeš ju tak spraviť. Tak to bude asi najlepšie. Ano, tak to vskutku můžeš dělat. Ale při programování fitness funkce by to tak dělalo jenom nechutné programátorské hovado. Písal som o funkciách všeobecne, nie konkrétne o fitness funkcii. Navrhnul jsi… Číst vice »
koroslav
koroslav
V C++ nie je nutné funkciu deklarovať. Slušný programátor deklaruje A pokiaľ je funkcia typu void nekončí, ani návratovou hodnotou. fitness funkce by měla vrátit buď hodnotu nebo aspoň pořadí. Data môžeš presúvať do globálne deklarovaných polí alebo cez pointery napr. v argumente funkcie. Ano, tak to vskutku můžeš dělat. Ale při programování fitness funkce by to tak dělalo jenom nechutné programátorské hovado. Navrhnul jsi fitness funkci s jedenácti návratovými hodnotami To je špatný design. Celý tvůj popis fitness funkce je jako popis někoho, kdo evoluční algoritmu nikdy v životě… Číst vice »
Foton
Foton

….A okrem toho som ti už na začiatku povedal, že existuje ešte jedna alternatíva, pokiaľ sa ti nechce programovať fitness funkciu. Ty budeš fitness funkcia. Vzniklý reťazec si prečítaš a ohodnótíš od 0 do 10. Zvyšok algoritmu už necháš na PC.

Foton
Foton
Vymyslel sis analogii. Já jsem řekl, že naprogramuju evoluční algoritmus, když mi dodáš fitness funkci. Práve som ti ju popísal, podľa čoho sa máš pri jej programovaní držať. Funkce začíná deklarací, definicí a končí návratovou hodnotou. V C++ nie je nutné funkciu deklarovať. A pokiaľ je funkcia typu void nekončí, ani návratovou hodnotou. Data môžeš presúvať do globálne deklarovaných polí alebo cez pointery napr. v argumente funkcie. Ty jsi dodal jenom kecy, ani ne algoritmus k výpočtu té funkce. Popis algoritmu nie sú kecy. Zadanie máš. Nekecaj a programuj A… Číst vice »
koroslav
koroslav

Vymyslel sis analogii. Já jsem řekl, že naprogramuju evoluční algoritmus, když mi dodáš fitness funkci. Funkce začíná deklarací, definicí a končí návratovou hodnotou. Ty jsi dodal jenom kecy, ani ne algoritmus k výpočtu té funkce.
A ještě jednou. Jaké má tvoje „funkce“ návratové hodnoty. Je to 11 integer hodnot 0-10?

Foton
Foton
koroslav Potom som ale vykonal jednu opravu, lebo som sa sekol. Čiže nenulový fitness má iba veta s významom. Lorem ipsum význam nemá, preto rovnako ako náhodný reťazec znakov fitness=0. Rovnako v biosfére má nenulový fitness iba proteín, ktorý plní nejakú funkciu, viac alebo menej prospešnú pre organizmus. Podľa miery prospešnosti sa určí jeho hodnota. Rovnako veta: čím bude jej významový obsah pre človeka prospešnejší, tým bude jej fitness vyšší na stupnici od 1 do 10. Napríklad veta „Domnievam sa, že myslím a predpokladám, že sa nazdávam.“ Má fitness 1,… Číst vice »
Václav Dostál
Václav Dostál
Všem a panu SSK zvláště Ve svém příspěvku z 31. 5. 17:05 jsem zaměnil osoby. Nyní uvádím text druhého odstavce tohoto příspěvku s opravou: Na rozdíl od současných tvrzení jste uvedl něco jiného: [Dodatečná oprava 2. 6. 2017: Na rozdíl od těchto tvrzení uvedl Koroslav něco jiného] Koroslav 27.5. 8:50 „Rozdíl mezi Biologickým EA a „programátorským“ EA: … V biologii je to mnohem složitější“ Jestliže existuje „biologický“ evoluční algoritmus tak KDE? Tamtéž: „V živých organismech je zakódovaná schopnost replikace…“ Jestliže je v organismus zakódovaná schopnost replikace, pak NENÍ zakódovaná pomocí… Číst vice »
Václav Dostál
Václav Dostál
Všem a panu SSK zvláště Ve svém příspěvku z 31. 5. 17:05 jsem zaměnil osoby. Nyní uvádím text druhého odstavce tohoto příspěvku s opravou: Na rozdíl od současných tvrzení jste uvedl něco jiného: [Dodatečná oprava 2. 6. 2017: Na rozdíl od těchto tvrzení uvedl Koroslav něco jiného] Koroslav 27.5. 8:50 „Rozdíl mezi Biologickým EA a „programátorským“ EA: … V biologii je to mnohem složitější“ Jestliže existuje „biologický“ evoluční algoritmus tak KDE? Tamtéž: „V živých organismech je zakódovaná schopnost replikace…“ Jestliže je v organismus zakódovaná schopnost replikace, pak NENÍ zakódovaná pomocí… Číst vice »
koroslav
koroslav

Foton>>
Takže chápu správně, že tvoje fitness funkce bude vrace na výstupu jenom hodnoty 10, 6, 3 a 0? Nerad bych, abychom se špatně chápali.

Vete ktorá obsahuje nejaký v praxi použiteľný poznatok

Hodně štěstí, až budeš tohle programovat.

Jazyk C.

Výborně, počkám si tedy, až dodáš céčkovou knihovnu, kde to bude naprogramované.

Foton
Foton

A kdopak tu po nás chtěl evolučně vyvinout z (konkrétní) Pythagorovy věty (konkrétní) Archimedův zákon? Nebyl to Foton? Nebo snad Chameleon? A-darwinista?

Vidím, že za život ťa teda myslieť nenaučili. To boli príklady ty klamár. Nie tvrdenie „takto to bolo“.

Ne, Fotonku, z Pythagorovy věty se mutacemi a selekcí Archimedův zákon s velmi vysokou pravděpodobností nestane. To ale evoluční teorii nevyvrací.

Kľudne akýkoľvek iný zákon. Pôvodne bola reč o novej múdrosti, ktorá na svete ešte nikdy nebola. (To by si ale najprv musel vedieť čítať.)

KTE

Z epitelu sa nikdy nestane rhodopsín. Z Pythagorovej vety Archimedov zákon. Alebo áno? (http://kreacionismus.cz/mohl-by-nejaky-algoritmus-vzniknout-samovolne-spontanne-bez-pusobeni-inteligentni-osoby/comment-page-4/#comment-711)

A kdopak tu po nás chtěl evolučně vyvinout z (konkrétní) Pythagorovy věty (konkrétní) Archimedův zákon? Nebyl to Foton? Nebo snad Chameleon? A-darwinista?

Ne, Fotonku, z Pythagorovy věty se mutacemi a selekcí Archimedův zákon s velmi vysokou pravděpodobností nestane. To ale evoluční teorii nevyvrací.

Foton
Foton

Teraz vidím, že evoparanoici po mojom včerajšom upozornení dobehli zamežkané. 😛

Foton
Foton
KTE Už se zase kroutíš jak slizký černý had. Ako had sa krúti ten, kto mi vložil do úst „vznik konkrétního genu B z konkrétního genu A„. Áno tam kde nie sú argumenty, prichádza na radu podvod a projekcia. (A za chvíľu ad hominem.) Evoluce nepotřebuje, aby mohl vznikat gen z genu zásadně odlišného. Ak nemôže postupnými zmenami vzniknúť jeden gén zo zásadne odlišného, evolučná teória neplatí. (Buď nevieš, čo je to „Evolučná Teória“, alebo ťa za života zabudli naučiť myslieť.) Foton ukáže na gen A, ze kterého nemůže evolučně… Číst vice »
Foton
Foton

SSk
Samozrejme, že to nie je dojmológia. Douč sa variácie. Rovnako biochémiu, lebo o nej čerpáš informácie len z toho, čo si o nej myslíš.

KTE

Nehovoril som konkrétního, ale akéhokoľvek zásadne odlišného.

Už se zase kroutíš jak slizký černý had. Evoluce nepotřebuje, aby mohl vznikat gen z genu zásadně odlišného. Jestliže nějaký Foton ukáže na gen A, ze kterého nemůže evolučně vzniknout gen B, evoluční teorii to nijak nevyvrací.

SSK-neprihpaseny
SSK-neprihpaseny

Václave, ja bych sice mohl nazvat něco z toho, o cem jsem mluvil, instrukcemi, ale vy byste z toho vyvodil, že jsou to zprávy, které tam někdo uložil. To, co vy si pod pojmem informace nebo instrukce představujete, skutečně v žádném organismu ani jeho části ulozeno není.

Václav Dostál
Václav Dostál
Reakce na text SSK uložený dnes (1.6.) v 9:13 Vlastnosti organismu nejsou nikde zakódovány. :VD (31. 5. 17:05): Informace, která NENÍ uložena NIKDE, nemá pro živý organismus žádný smysl, nemůže ji „číst“. Toho jste si nepovšiml Píšete něco protikladného vzhledem ke Koroslavovi Koroslav 27.5. 8:50 „Rozdíl mezi Biologickým EA a „programátorským“ EA: … V biologii je to mnohem složitější“ VD:Jestliže existuje „biologický“ evoluční algoritmus tak KDE? Tamtéž: „V živých organismech je zakódovaná schopnost replikace…“ VD: Jestliže je v organismus zakódovaná schopnost replikace, pak NENÍ zakódovaná pomocí instrukcí (používajících kódovacích „biologických“… Číst vice »
SSK

Foton

Je tak zložitá, že by nestačilo na jej vznik ani najvyššie čislo Vesmíru – tj. počet atómov krát počet najkratších časových okamihov do ktorých sa ešte zmestia chemické reakcie.

To je jenom tvoje dojmologie a zejména to je zcela nepodložené tvrzení. Můžeš kolem toho nakecat spoustu svých oblíbených klamů, ale nic jiného, než tvůj dojem to nebude.

Foton
Foton
Vlastnosti organismu nejsou nikde zakódovány. Už väčšiu sprostosť evolucionista zo seba ani nemohol vypotiť. Pripadáš si normálny? Alebo nerozumieš slovu „vlastnosť“. Chcelo by to, aby si si zopakoval ranný vývoj detstva, kde rodičia deti učili rozumieť významu slov. Taková změna může způsobit, že se tento protein bude hůř odbourávat (bude hůř štěpitelný lyázami) A týmto chceš budovať novú informáciu? Jelikož je to transkripční faktor, tak samozřejmě bude transkribovat geny, které transkribuje A to, ktoré gény transkribuje a ako, robí darwinko? což může vést třeba k prodloužení růstu končetin během embryogeneze.… Číst vice »
jhk - vlasta
jhk - vlasta

Vlastnosti organizmu ve smyslu -. co to bude – jsou samozřejmě zakodovany v DNA. A tím je určené, jaké vlastnosti bude mít výsledný organizmus, pokud ve vývoji bude pokračovat všechno tak, jak má.

jhk - vlasta
jhk - vlasta
SSK Vlastnosti organismu nejsou nikde zakódovány. Ty vznikají během ontogenetického vývoje jako důsledek interakce molekul přítomných v zygotě s prostředím. To bych tak vesele netvrdil. Jaké vlastnosti? Lidské? Navíc je organismus jenom přechodná krabice na přenos genů. – Rozdělovat nerozdělitelné a říkat, že něco je „pouze“ pro to druhé – je zavádějící poukazování na to, abych mohl něčím argumentovat – v tomto případě tím, že tělo je „pouze“ „krabice“ a důležité jsou geny. Ne. Geny jsou pro tělo a tělo pro geny. Jedno bez druhého je k ničemu. Obojí dvojí… Číst vice »
SSK
SSK
Václav Dostál ČÍM je zakódovaná schopnost (celkem jakákoli) organismu jestliže ne „biologickým“ kódem, který pak je součástí DNA? Zakódované vlastnosti organismu NEJSOU uloženy ani v organismu ani mimo něj? Nejsou uloženy NIKDE? Vlastnosti organismu nejsou nikde zakódovány. Ty vznikají během ontogenetického vývoje jako důsledek interakce molekul přítomných v zygotě s prostředím. Jisté vlastnosti organismu lze předvídat z jeho genotypu, ale to neznamená, že jsou v něm zakódovány. Jenom interakce toho či onoho genotypu s prostředím obvykle dopadá tak či onak. Mutace v DNA nezpůsobí změnu nějaké uložené instrukce. Představte si… Číst vice »
Foton
Foton

KTE
proč nemožnost vzniku konkrétního genu B z konkrétního genu A

Nehovoril som konkrétního, ale akéhokoľvek zásadne odlišného.

Foton
Foton

Vidím, že posledných 17 príspevkov v tejto téme veľa evolucionistov nečítalo…

Foton
Foton

George
Je šuma fuk, že si nereagoval na mňa. Si vo verejnej diskusii. Nechápem, prečo vy evolucionisti často opakujete tento smiešne primitívny škôlkarský argument. Keď nechceš reagovať, tak nereaguj. Nebuď rozpoltený. Ja budem reagovať na koho sa mi zachce a kedy sa mi zachce. 😉

V čom som mimo?

Foton
Foton

KTE
Ty si nepochopil, že vyvrací.

George
George

Foton: To, že sú nekódujúce neznamená, že nemajú žiadny význam.

A proc mi to jako pises? Jednak jsem nereagoval na tebe a jednak vubec nikde nic takoveho netvrdim. Ty uz jsi vazne uplne mimo.

Václav Dostál
Václav Dostál

Biotypovi
Citát z
http://www.radford.edu/~rsheehy/Gen_flash/ABLE_Workshop/Popgen_Equations.pdf
„Now, imagine that you can somehow také all the gametes“
Této citát mi prozatím stačí, hlavně pro uvedení slova „nějak“. To je exaktní vyjádření?
Čekám na odpověď pana SSK

KTE

Fotone,
a už jsi pochopil, proč nemožnost vzniku konkrétního genu B z konkrétního genu A nevyvrací evoluční teorii?

Foton
Foton

biotyp:
Rozumieš vôbec tomu, čo je tam napísané?

Foton
Foton

SSK

Vždyť jsem vám to napsal. Vlastnosti genů/organismů vyplývají z fyzikálně chemických vlastností atomů a molekul, z nichž jsou složeny.

Podobne vlastnosti polovodičových pamätí vyplývajú z fyzikálně chemických vlastností atomů a molekul, z nichž jsou složeny. Chceš tým povedať, že zmysluplné informácie ktoré sa do nich ukladajú sú dielom tých vlastností? (Evolucionistovi to nikdy nemyslelo!!! Srandista…)

biotyp
biotyp

Václavovi: základy vč. rovnic např.zde:

http://www.radford.edu/~rsheehy/Gen_flash/ABLE_Workshop/Popgen_Equations.pdf

nebo tady ještě lépe:
http://www.ib.usp.br/genevol/images/papers/gillespie.pdf
zde fitness na str 51 a dál.

Václav Dostál
Václav Dostál
Pro SSK: Vlastnosti genů/organismů vyplývají z … Na TOHLE jsem se neptal! Takže: ČÍM je zakódovaná schopnost (celkem jakákoli) organismu jestliže ne „biologickým“ kódem, který pak je součástí DNA? Zakódované vlastnosti organismu NEJSOU uloženy ani v organismu ani mimo něj? Nejsou uloženy NIKDE? Informace, která NENÍ uložena NIKDE, nemá pro živý organismus žádný smysl, nemůže ji „číst“. SOUHLASÍTE s poslední větou? Jestliže ano pak znovu: Jsou či nejsou zakódované vlastnosti organismu uloženy v organismu (např. v DNA) ? Jsou či nejsou uloženy NIKDE? UPOZORŇUJI: Můj počítač se nyní bortí tak,… Číst vice »
SSK
SSK
Václav Dostál Vždyť jsem vám to napsal. Vlastnosti genů/organismů vyplývají z fyzikálně chemických vlastností atomů a molekul, z nichž jsou složeny. Skoro mi připadá, že po mně chcete sjednocující teorii všeho. Např. molekuly RNA mohou v závislosti na své sekvenci jenom pasivně existovat v roztoku nebo mohou štěpit okolní molekuly či se replikovat. RNA molekuly o různých sekvencích mají prostě různé chemické a fyzikální vlastnosti. Na tom není nic divného. RNA molekuly, které jsou schopny replikace, budou podléhat evoluci a také přirozenému výběru. A podobně to funguje u komplexnějších replikujících… Číst vice »
Václav Dostál
Václav Dostál
Pro SSK Žádný uložený program, který by tam vložil nějaký programátor a který by předepisoval, co se má v té které chvíli dít, v organismech není. Ani program uložený „přírodou“? Organismus NENÍ řízen? Jednotlivé části organismu nedostávají ŽÁDNÉ instrukce, protože v tom organismu žádné instrukce uloženy nejsou?? Čím je řízen růst dítěte do dospělého stavu? (Jestliže žádné řízení nebo žádný algoritmus/program (uložený) v organismu neexistuje?) Na rozdíl od současných tvrzení jste uvedl něco jiného: Koroslav 27.5. 8:50 „Rozdíl mezi Biologickým EA a „programátorským“ EA: … V biologii je to mnohem… Číst vice »
Foton
Foton

koroslav
Musím vykonať jednu opravu (sekol som sa). Lorem ipsum nemá žiaden význam pre príjemcu, preto je jeho fitness bude 0. Fitness je nenulový teprv až vtedy, keď veta ako celok má nejaký význam. Ten sa očísluje podľa miery praktickej použiteľnosti. Čiže vyberať sa môžu len vety s významom.
….Mnohé gény síce obsahujú nadbytočné (zbytočné) inormácie, ale tie sú zostrihnuté a nakoniec z toho vyjde predloha pre tvorbu funkčného proteínu. A práve táto funkčnosť (význam pre organizmus) je mierou fitness.

Foton
Foton
SSK Navíc kreacionisti většinou neznají jiné mutace než singlenukleotidové substituce, inzerce nebo delece. Ale to je jenom zlomek mutací. Samozrejme vieme aj o iných mutáciách, ale tie sú stále o tom istom – akurát sa pracuje s väčšími (opäť náhodne) ohraničenými a vybranými celkami, ktoré sa presúvajú. Vieme aj o transpozonoch a ďalších veciach, ale to už nie je o náhode, ale o určitom mechanizme. Preto zostaňme u jednonukleotidových náhodných mutáciach. Jak víte, že kromě abc nemají další řetězce význam? Lebo nám nič nehovoria. Je to analógia. V tejto analógii… Číst vice »
SSK
SSK
Václav Dostál Opravdu v organismu NENÍ ŽÁDNÝ algoritmus? Z ČEHO se skládá program, který v organismu (i podle Vás) uložený je? Nejsou-li to algoritmy, CO TO JE? Ne. Žádný uložený program, který by tam vložil nějaký programátor a který by předepisoval, co se má v té které chvíli dít, v organismech není. Organismus je pouze shluk atomů a veškeré jeho interakce s okolím a jinými organismy se ve své podstatě řídí fyzikálními/chemickými zákony. Opravdu nic neřídí algoritmické instrukce (např. „mutuj“), kteréžto instrukce JSOU součástí algoritmu a tedy programu v organismu… Číst vice »
Václav Dostál
Václav Dostál
Pro SSK Správně píšete, že podle vás. Ale to je asi váš problém, Václave. [že Darwinova a Vaše formulace není exaktní] Exaktnost ve fyzice znamená matematické vyjádření. Jestliže by někdo formuloval fyzikální zákon tak, jak to formuluje Darwin nebo Vy) a Fyzik by to onomu formulujícímu vytkl, tak by to byl problém toho fyzika?? Uvedl jsem jak. To je mírou, jakou znak ovlivní v aktuální kontextu produkci potomstva. Ale já pořád po Vás chci PŘESNOU čili EXAKTNÍ formulaci, tedy formulaci podobnou znění jakéhokoliv fyzikálního zákona! Já nemám ambici psát vám… Číst vice »
SSK
SSK
Václav Dostál Darwinova formulace a Váš výklad/komentář NEJSOU podle mě exaktní. Správně píšete, že podle vás. Ale to je asi váš problém, Václave. V obojím je sice jaksi uvedeno NA ČEM fittnes jedince závisí, ale na otázku „JAK“ přesná odpověď chybí. Uvedl jsem jak. To je mírou, jakou znak ovlivní v aktuální kontextu produkci potomstva. (Nehledě na obecnou zákonitost platící v celé populaci, o níž tvrdíte, že není předmětem zájmu dané teorie). Nic takového netvrdím. Postrádám také Vaše řešení problému, jakým mechanismem se samovolně dostane jediná instrukce do řídícího algoritmu… Číst vice »
Václav Dostál
Václav Dostál
Pro SSK Darwinova formulace a Váš výklad/komentář NEJSOU podle mě exaktní. Popis je mlhavý – neodpovídající požadavku PŘESNOSTI. V obojím je sice jaksi uvedeno NA ČEM fittnes jedince závisí, ale na otázku „JAK“ přesná odpověď chybí. (Nehledě na obecnou zákonitost platící v celé populaci, o níž tvrdíte, že není předmětem zájmu dané teorie). Znáte tu přesnou odpověď? Existuje vůbec? Postrádám také Vaše řešení problému, jakým mechanismem se samovolně dostane jediná instrukce do řídícího algoritmu – který je v organismu – a to svým obsahem a také svým místem v algoritmu.… Číst vice »
SSK
SSK
Václav Dostál Dobrá, ale může. Jestliže k ní dojde, tak podle jakého zákona? Václave, mně připadá, že si ze mě děláte legraci. Vždyť to víme už od Darwina, když to formuloval ve své knize Origin of Species: …if variations useful to any organic being do occur, assuredly individuals thus characterised will have the best chance of being preserved in the struggle for life; and from the strong principle of inheritance they will tend to produce offspring similarly characterised. This principle of preservation, I have called, for the sake of brevity,… Číst vice »
Václav Dostál
Václav Dostál
Pro SSK To, že V populaci dochází k selekci jedinců, neznamená, že je selektována ona populace. Samozřejmě, že neznamená. Jestliže ovšem dochází k selekci uvnitř populace, pak by měla probíhat podle nějaké zákonitosti. JAK TA ZÁKONITIOST zní?? PŘESNĚ, EXAKTNĚ!! (Ten zákon tedy platí pro populaci jako celek a ne jako část nějaké metapopulace) V populaci selekce probíhat nemusí. Dobrá, ale může. Jestliže k ní dojde, tak podle jakého zákona? Přesně, exaktně, nikoli: že to závisí na tom či onom ale JAK (podle jakého zákona. To už píšu zde poněkolikáté, poněvadž… Číst vice »
SSK
SSK
Václav Dostál Takže v populaci JAKO CELKU dochází k selekci! To, že V populaci dochází k selekci jedinců, neznamená, že je selektována ona populace. Už nevím, jak jinak to říct. Selektují se jedinci v populaci ne populace v metapopulaci. Lze tuto „zákonitost“ vyjádřit exaktně nebo nelze?? (Exaktně znamená matematicky. Spokojím se ale i se slovním vyjádřením oné zákonitosti, jen musí být přesné. Mělo by se tedy podobat slovnímu znění kteréhokoliv fyzikálního zákona. Dosavadní Vaše vyjádření se tomu nepřibližuje ani zdaleka) Jaká zákonitost? V populaci selekce probíhat nemusí. To, jestli a… Číst vice »
Václav Dostál
Václav Dostál
Pro SSK Populace prostě není subjektem darwinovské selekce. Jestliže slovo „subjekt“ znamená „předmět“, pak věta „Populace prostě není předmětem darwinovské selekce“ neplatí. Populace jedinců přece podle téhož kritéria se skládá z jedinců o různém fittness a méně zdatní jedinci jsou z té populace vyřazováni. Takže v populaci JAKO CELKU dochází k selekci! Lze tuto „zákonitost“ vyjádřit exaktně nebo nelze?? (Exaktně znamená matematicky. Spokojím se ale i se slovním vyjádřením oné zákonitosti, jen musí být přesné. Mělo by se tedy podobat slovnímu znění kteréhokoliv fyzikálního zákona. Dosavadní Vaše vyjádření se tomu… Číst vice »
SSK
SSK
Václav Dostál NIJAK jste nereagoval na mé námitky v příspěvku z 29.5. v 17:51, a docela „klidně“ nyní reagujete na něco jiného. Máte k tomu právo, ale naprosto stejné právo mám já nyní – tedy nereagovat na Váš poslední příspěvek. Můžete mi nadávat nebo mně pomlouvat, ale já se budu řídit Vaším příkladem. Nevím, co víc bych dodal. Populace prostě není subjektem darwinovské selekce. Tím je jedinec, pokud uvažujeme inkluzivní fitness, nebo gen sensu Dawkins. I v těch evolučních algoritmech se v souladu s tímto faktem selektují jedinci, nikoli populace… Číst vice »
jhk - vlasta
jhk - vlasta

https://www.novinky.cz/zena/439216-proc-jsou-zubni-korunky-tak-drahe-aneb-kolik-casu-zabere-vyroba-jednoho-zubu.html

např. zde použité slovo až na konci příspěvku – designovat. Bylo by klidně možné to říci česky – upravovat tvar zubu. Slova tedy vytváří člověk podle „své“ potřeby.

Václav Dostál
Václav Dostál

SSK
NIJAK jste nereagoval na mé námitky v příspěvku z 29.5. v 17:51, a docela „klidně“ nyní reagujete na něco jiného. Máte k tomu právo, ale naprosto stejné právo mám já nyní – tedy nereagovat na Váš poslední příspěvek.
Můžete mi nadávat nebo mně pomlouvat, ale já se budu řídit Vaším příkladem.

jhk - vlasta
jhk - vlasta
Ale tak tomu není, významy vznikají teprve v kontextu a tentýž řetězec, třeba „dba“ může mít několik různých významů v různých kontextech nebo taky žádný význam. Já bych to spíše řekl asi trochu jinak. Pokud by tady nebyl žádný člověk, nebude mít význam ani jedna kombinace, protože to nebude mít žádný smysl pro zvířata, aby jim někdo něco říkal. Oni prostě mají jinou „sadu znaků….“. Takže když člověk bude chtít a bude to používat – budou mít význam všechny kombinace. Pokud to bude pro člověka potřebné a využije všech kombinací,… Číst vice »
SSK
SSK
Václav Dostál Co (jaký děj) vyvolá mutaci? Vnější podmínky (teplota, atmosférický tlak, záření, …) mohou pouze tento děj podnítit, avšak existuje takový děj – taková příčina způsobující mutaci? Jestliže ano, pak ať ji někdo uvede. Příčiny mutací samozřejmě známe velmi dobře. Na vysoké škole jsem absolvoval semestrální kurz s názvem Mutageneze, kde se přesně tohle řešilo. Navíc kreacionisti většinou neznají jiné mutace než singlenukleotidové substituce, inzerce nebo delece. Ale to je jenom zlomek mutací. Singlenukleotidové mutace vznikají např. zařazením nesprávného nukleotidu při replikaci. Např. UV záření způsobuje vznik cyklobutanpyrimidinových dimerů… Číst vice »
Václav Dostál
Václav Dostál
Příčina mutací je dejme tomu neznámá, a přesto k nim dochází. Gen se změní – většinou nepříznivě, tj. na nesmyslný. Potom začne fungovat porovnávání se zálohovaným genem a nesmyslný gen je opraven na svůj původní tvar a tedy i význam. Pokud vznikne gen s významem, je zřejmé, že ten význam bude jiný, než byl původně. Načež začne fungovat oprava. Když bude množství nepříznivě změněných genů veliké, dojde ke kolapsu. Dlouhý genom a genofond bude také obsahovat delší zálohu a pravděpodobně i vícenásobnou (nejen dvojnásobnou). Tento mechanismus bych nazval „vnitřní selekce“,… Číst vice »
Václav Dostál
Václav Dostál
Mutace Vybral jsem anglické slovo „abc“, které má význam „abeceda“, popř. „základy.“ Provedu s ním mutace. Přitom lze použít pouze čtyř písmen a, b, c, d, což odpovídá čtyřem „písmenům“ v DNA. Výchozí slovo, představující gen, musí mít význam (smysl) a jeho mutace ovšem také. Mutací vzniklý nesmyslný gen bude pro organismus nevýhodný a bude tedy selekcí vyloučen. slovo význam abc abeceda acb nemá význam abd nemá význam dbc nemá význam abb nemá význam aaa nemá význam adb nemá význam dba nemá význam atd. K tomu přistupuje otázka příčiny mutace… Číst vice »
Foton
Foton
Bez problémů. Ale vzhledem k tomu, že sis vymyslel analogií s větou, potřebuju od tebe funkci, kterou sis vymyslel v bodě 6 a dál. Význam vety nie je nič vymyslené. Vete ktorá obsahuje nejaký v praxi použiteľný poznatok môžeme priradiť fitness 10. Vete ktorá síce má zmysel ale nemá praktický význam fitness 6. Vete typu Lorem ipsum fitness 3. Náhodným znakom fitness 0. Chcel si začať 100 náhodne vybranými znakmi. Tu ich máš: sdggpfj nb54gg7-ggf rd-d:58dfaaerpn vmaswqhfdgt?84gopqwer9 8bnds!fff.f dd gererepm eda9bgkerlv; 078r Nejsem vybíravý, programovací jazyk si zvol podle sebe,… Číst vice »
jhk - vlasta
jhk - vlasta

Tedy rozumím KTE-mu, ale nerozumím Koroslavovi. O co mu jde? Vždyť nemá to základní, co je třeba – a to je samovolný vznik života. Jak potom chce dokazovat, že je možné, aby se něco měnilo? Když není A – tak prostě není B.

koroslav
koroslav
Foton: Predveď to. Bez problémů. Ale vzhledem k tomu, že sis vymyslel analogií s větou, potřebuju od tebe funkci, kterou sis vymyslel v bodě 6 a dál. 6. Vyber najlepšiu z viet podľa jej významu a rozmnož ju (kopírovaním) na ďalších 10 jedincov. …Okamžite vidno, že úspech algoritmu stojí a padá na kvalite výberu vety podľa fitness jej významu (bod 6). Na to je treba zostrojiť program, ktorý bude buď obshovať databázu všetkých možných zmysluplných viet (=veľké množstvo dat), alebo všetky slová českého/slovenského jazyka + algoritmus gramatických pravidiel a platných… Číst vice »
jhk - vlasta
jhk - vlasta

•Z pohledu typu postižených buněk u vyššího organizmu (například u člověka) dělíme mutace na somatické a gametické

– takovéto názory mě vždy rozesmějí. Bez mutací by neexistoval člověk – a přeci zde tvrdí, že jako by všechny mutační změny měly snad působit jen zlo? )))))))))))

– když už, tak tam napíšu – z pohledu mutací pozměněných buněk – a ne postižených. To je jako kdyby se mluvilo jen o nějakých pacientech….

jhk - vlasta
jhk - vlasta

http://www.genetika-biologie.cz/mutace

Mutace jsou změny v genotypu organismu oproti normálu. – tomu nerozumím. Na počátku dle evoluce mělo být něco, co bylo tedy normální a mutacemi se to vyvinulo do dnešní podoby? Proč tady potom říkají, že jsou to nějaké změny oproti „normálu“? Normální je přeci to, co vzniklo mutacemi při dlouhých milionech let…..

KTE

Fotone,
pokud stále nechápeš, proč nemožnost vzniku konkrétního genu B z konkrétního genu A nevyvrací evoluční teorii, mohl by sis to nechat vysvětlit od Vlastíka.

Foton
Foton

George
To, že sú nekódujúce neznamená, že nemajú žiadny význam. Veď už stačí, keď si svoje heslo zadáš do googla a musí ti zapáliť, že žiješ 10 rokov pozadu. 😉

Foton
Foton

KTE
Zas typické konšpiračné teórie jedného evolucionistu, ale nič k téme. To sa chcete donekonečna potľapkávať po pleci takouto škôlkarčinou? Mínusy na mojich príspevkoch sú pre mňa indíciou, že ich čítal ten, kto mal. A čím viac mínusov, tým lepší príspevok bol a tým lepšie splnil svoj cieľ. 😉

George
George

Není to možné, protože v genu je spousta informací duplikovaných, je tam spousta úseků, které nekódují nic podstatného a jejich změnou se nic nezkazí.

Viz heslo „konzervativni nekodujici sekvence“.

KTE

KTE sice už odpověděl, ale v podstatě jsem to samé chtěl říci trochu jinak. Je jedno, zdali se z genu A nemůže vytvořit gen B, či jakýkoli jiný gen, protože se to může vytvořit za jiných podmínek z jiného existujícího genu na jiném místě např. z genu C, nebo D, nebo E. Možností je spousty.

Tentokrát jsem já tak úplně nepochopil, proč je Vlasta omínusován, když kupodivu souhlasí se mnou a ne s Fotonovičem. Možná však ty minusy pocházejí od Fotona, Chameleona, C.M.L. a A-darwinisty.

Pacak
Pacak

„Není to možné, protože v genu je spousta informací duplikovaných, je tam spousta úseků, které nekódují nic podstatného a jejich změnou se nic nezkazí…“ Obrovský pokrok v poznání genomu „bílá“ místa likviduje. Už tam nežijí lvi, ale začínáme tušit jejich smysl.

Václav Dostál
Václav Dostál

Oznamuji, že jsem tento článek okopíroval a vsunul jako 13. kapitolu své knihy „Kreativní informace“, a pak jsem tam vsunul „Reakci“ – část zdejší diskuze – jako kapitolu 14. V knize pak následují tři kapitoly, které tam už byly a jejichž autory jsou jiní lidé než já.
Adresa knihy je: http://vaclavdostal.8u.cz/informace.pdf. Pokud si někdo „stáhl“ předchozí verzi, může ji nyní vymazat a uložit si tu novou.

jhk - vlasta
jhk - vlasta
Koroslav – Řekněme tedy, že funkce 6 poskytuje číselný údaj o nesmyslnosti věty. Čím lepší dává věta smysl tím nižší bude její funkční hodnota. Pokud začneme s řetězcem 100 náhodných znaků f(V) = funkční hodnota věty V bude vysoká. Evoluční algoritmus aplikovaný na takovouto náhodnou větu by poměrně rychle konvergoval do nějaké smysluplné věty. Pokud ovšem začneme ve větě, která sama o sobě dává smysl (F(V) je nízká), je každá její změna zhoršením smyslu. Tomu se říká problém lokálního minima. Vypadá to jako neřešitelný problém pro evoluci, ale to není… Číst vice »
jhk - vlasta
jhk - vlasta
Koroslav – Není to možné, protože v genu je spousta informací duplikovaných, je tam spousta úseků, které nekódují nic podstatného a jejich změnou se nic nezkazí. Když bys chtěl gen k něčemu mermomocí přirovnat, tak mnohem výstižnější budou slova rozházená ve směsici různých znaků. Tak a teď je na řadě vysvětlit, proč je tvůj příklad s Pythagorovou větou vyložený argumentační faul – je mi v podstatě zcela jedno, na co se reaguje, ale ta první věta je „pouhá domněnka“, kterou Koroslav nemůže jakkoli dokázat, protože velmi jednoduše neví – jestli… Číst vice »
jhk - vlasta
jhk - vlasta

Jestliže se evolučně z genu A nemůže vyvinout gen B, nijak to evoluční teorii nevyvrací.

KTE sice už odpověděl, ale v podstatě jsem to samé chtěl říci trochu jinak. Je jedno, zdali se z genu A nemůže vytvořit gen B, či jakýkoli jiný gen, protože se to může vytvořit za jiných podmínek z jiného existujícího genu na jiném místě např. z genu C, nebo D, nebo E. Možností je spousty.

Foton
Foton

Ešte by som chcel podotknúť, že lepšie bude sa baviť o proteínoch, než génoch, aby sme to zbytočne nekomplikovali tripletmi, tichými mutáciami, intronmi, splicingom, transkripciou atď… Takže Pythahorova veta vs. proteín….

Foton
Foton
Nevyskakuj. Keď sa ti nechce strácať čas tak nestrácaj. Si rozpoltená osobnosť? Není to možné, protože v genu je spousta informací duplikovaných, je tam spousta úseků, které nekódují nic podstatného a jejich změnou se nic nezkazí. Ale ani nezíska. Když bys chtěl gen k něčemu mermomocí přirovnat, tak mnohem výstižnější budou slova rozházená ve směsici různých znaků. Nie je problém vytvoriť text z nadbytočnými vetami. Napr. Spomínaný problém však trvá. Nijak si s tým nepomôžeš. Pokud začneme s řetězcem 100 náhodných znaků f(V) = funkční hodnota věty V bude vysoká.… Číst vice »
koroslav
koroslav
Fotone, už mě tvoje lži přestávají bavit. Možná si myslíš, jak jsi to všem nandal, ale to je jenom tvoje iluze. Nechce se mi s tebou ztrácet čas, protože vím, že se začneš vykrucovat (lépe řečeno už se vykrucuješ, protože tvůj klam jsem odhalil v prvním příspěvku), ale pro ty, kteří nevědí, co je to problém lokálního optima, ten tvůj rádobyskvělý příspěvek rozeberu. Gén je možné prirovnať k vete. Není to možné, protože v genu je spousta informací duplikovaných, je tam spousta úseků, které nekódují nic podstatného a jejich změnou… Číst vice »
Foton
Foton

Áno, vyvracia. Evolučná teória je o pôvode druhov zo spoločných predkov. Rovnako ale aj o evolučnom pôvode orgánov a končatín + ich príslušných génov.

KTE

Gén sa nemohol postupnými zmenami vyvinúť z iného, ktorý svojim usporiadaním nukleobáz sa zásadne líši. Řekněme, že nemohl. No a co jako? To vyvrací evoluční teorii?

Foton
Foton

Gén sa nemohol postupnými zmenami vyvinúť z iného, ktorý svojim usporiadaním nukleobáz sa zásadne líši. Jedno, ako ich označíš.

KTE

Jestliže se evolučně z genu A nemůže vyvinout gen B, nijak to evoluční teorii nevyvrací. Může však existovat dvojice genů C a D, kde D se mohl vyvinout evolučně z C. Evoluce není pánbů, aby mohla všechno.

Foton
Foton
Jan Problém je v tom, že zmeny (hovoríme o náhodných zmenách) majú na pôvodne fungujúce zoskupenie kaziaci účinok. Spočiatku sa síce môže pritrafiť zmena (porucha) ktorá len upraví význam/funkciu (podobne ako existujú vety, v ktorých zmenou jedného znaku sa zmení jej význam). Ale ďalším postupným aplikovaním náhodných zmien na takýto systém sa skôr či neskôr dostaneme do bodu straty významu/funkčnosti. Algoritmus akým evolucionisti predpokladajú, že evolúcia prebieha, som popísal v tomto príspevku. Jednoducho z daných už existujúcich funkčných komplexov sa nemôžeme dostať k iným funkčným komplexom so zásadne odlišným usporiadaním… Číst vice »
Foton
Foton

Pochopitelne, že vyvrací. Ako inak…

Jan
Jan
Prispejem do debaty, ale skôr otázkami ako riešením. Evolučný algoritmus , ak niečo také reálne existuje v prírode, nie je zakódovaný v genofonde žiadneho organizmu. Tak to na základe všetkých svojich vedomosti o tom čo je to evolúcia chápem. Je tu nejaká úroveň usporiadania atómov, schopných reprodukcie, pri reprodukcii môžu vznikať zmeny. Zmes týchto nových reprodukcii so zmenami a reprodukcii bez zmien je vystavená výberu. Ťažko tu hovoriť o nejakej fitnes funkcii, lebo je to súbor meniacich sa interakcii prostredia a všetkých existujúcich typov usporiadania atómov schopných reprodukcie. Výsledkom by… Číst vice »
KTE

Jestliže se evolučně z genu A nemůže vyvinout gen B, nijak to evoluční teorii nevyvrací.

Foton
Foton

Evolucionisti sa proste len vrtia. Nič iného nedokážu. Abstraktné reči, posudzovanie oponentov, ale nič konkrétne. Žiadne vyjadrenie k facke, ktorú som vám vylepil Pythagorovou vetou. Proste nemáte na to, aby ste sa k tomu vyjadrili – lebo dobre viete, že to urobilo z vašou evolučnou báchorkou amen… 😛

Foton
Foton

KTE
Zas musíš trucovať? To se ví, že vyvrací! Medzidruhová evolúcia je proste len fikcia. (Dôkaz ktorý spochybňuje vznik jedného génu z iného zásadne odlišného postupnými zmenami som už priniesol.) 😉

KTE

Pro všechny kromě Fotona
Jestliže se evolučně nemůže z A (např. z převodovky) vyvinout B (např. raketový motor), nijak to evoluční teorii nevyvrací.

KTE

Pro Václav Dostál
Nezkusíte zde definovat exaktní funkci pro předpovídání počasí? Pokud to nelze, ptám se – je vůbec meteorologie exaktní věda?

Václav Dostál
Václav Dostál
Pro SSK: „Jedinec/gen je jednotkou selekce. Nikoli populace“ NEZNAMENÁ, že jedinec NENÍ jednotkou populace? Co je to za logiku??? VD: „NEPTÁM se na nějaké povídání či okecávání, ale ptám se na exaktní vyjádření fittness funkce platící v populaci jedinců – vyjádření matematické!!!“ K: „Jelikož populace nejsou předmětem selekce, tak to nedává biologický smysl. Jelikož populace nejsou předmětem selekce, tak to nedává biologický smysl.“ Biologie JE věda. Jakákoli věda se musí vyznačovat exaktností! Že populace NEJSOU předmětem selekce? Ale sekce může nastat pouze v případě, že existují alespoň dva jedinci, aby… Číst vice »
Foton
Foton
Udělal jsi chybu, když jsi tvrdil, že využití evolučního algoritmu je totéž co jeho přirovnání k vývoji genů. Vy toto prirovnávanie radi používate. Tak sa s nami nehraj… Neumíš to uznat. Opět. Co sis kde s kým vykládal a o co ti šlo, je naprosto nepodstatné a nezajímá mě to. Neumíš odpovědět na jednoduchú otázku, ktorú som všetkým evolucionistom položil na konci minule avizovaného príuspevku. Neumíš to uznat. To si radšej priznaj – a nehraj tu šaškárinu. Aj tak to nikam nevedie – a dobre to vieš. Co sis kde… Číst vice »
SSK

Foton

Nebudu s tebou vést zbytečnou diskuzi. Hraj si s někým jiným. Udělal jsi chybu, když jsi tvrdil, že využití evolučního algoritmu je totéž co jeho přirovnání k vývoji genů. Neumíš to uznat. Opět. Co sis kde s kým vykládal a o co ti šlo, je naprosto nepodstatné a nezajímá mě to.

SSK
Václav Dostál Jedinec NENÍ jednotkou populace To asi špatně čtete. Jak jste z toho, že jedinec/gen, nikoliv populace, je předmětem selekce, vyvodil, že jedinec není jednotkou populace? Samozřejmě, že jedinec je prvkem populace. Ale je to ten jedinec, kdo je selektován, nikoli ta populace. Vlastnosti populace jsou pasivním důsledkem selekce na úrovni jedinců. NEPTÁM se na nějaké povídání či okecávání, ale ptám se na exaktní vyjádření fittness funkce platící v populaci jedinců – vyjádření matematické!!! Jelikož populace nejsou předmětem selekce, tak to nedává biologický smysl. To se vám tu od… Číst vice »
Václav Dostál
Václav Dostál
VD: 1.„Jedinec/gen je jednotkou selekce. Nikoli populace.“ 2.„Jednotlivé prvky jsou jedinci a množina je jejich populace.“ Přidávám teoretické možnosti: a) platí JENOM věta 1; b) platí JENOM věta 2; c) Platí OBĚ dvě současnš; d) Neplatí ani jedna z nich. Která z možností a) až d) je podle Vás správná? K: „Která z možností a) až d) je podle Vás správná?“ Platí c). TUDÍŽ Jedinec NENÍ jednotkou populace A SOUČASNĚ jednotlivé prvky jsou jedinci a množina je jejich populace. To ovšem staví logiku na hlavu!! K: Napsal jste tohle: To… Číst vice »
Foton
Foton
Já nepoužívám analogii. Je jedno, z čeho jsou geny. Je úplně jedno, co je jednotkou selekce. Podstatný je ten iterativní evoluční algoritmus (tedy mutace -> selekce -> reprodukce). Presne ten používam v príspevku z 28.5.2017 13:43. Odpovedz na záverečnú otázku toho príspevku. A ten je naprosto stejný pro geny i pro cokoli jiného, kde se použije nebo se děje. Napríklad aj pre zmeny na tej Pythagorovej vete v hore avizovanom príspevku. Zbytek jsem nečetl. Nehodlám s tebou větvit a rozvádět diskuzi na jiné téma, abys opět zakryl svůj omyl. Vieme,… Číst vice »
SSK

Gény nie sú zložené z elektronických súčiastok, preto to nemôžeš porovnávať. Používate falošnú analógiu (Tento argument som si dovolil prepožičať od koroslava.)

Já nepoužívám analogii. Je jedno, z čeho jsou geny. Je úplně jedno, co je jednotkou selekce. Podstatný je ten iterativní evoluční algoritmus (tedy mutace -> selekce -> reprodukce). A ten je naprosto stejný pro geny i pro cokoli jiného, kde se použije nebo se děje. Zbytek jsem nečetl. Nehodlám s tebou větvit a rozvádět diskuzi na jiné téma, abys opět zakryl svůj omyl.

SSK

Václav Dostál

Napsal jste tohle: To nevadí, dalo by se použít statistiky a určit pravděpodobnost přežití větší populace jedinců.

Která z možností a) až d) je podle Vás správná?

Platí c).

jhk - vlasta
jhk - vlasta

RE: – Václav Dostál.

1.„Jedinec/gen je jednotkou selekce. Nikoli populace.“

Ano – Dawkins přišel s tím, že ta úroveň selekce není ani v jedinci, ale v genu, který má onen jedinec v sobě.

Ad.2 – to snad je správně ne?

Platí tedy myslím obě věty…. V.S.

Václav Dostál
Václav Dostál
SSK JHK Pokud tvrdíte, že se selektuje populace, tak se prostě mýlíte, což vyplývá i z toho odkazu, který jste postoval. NETVRDIL jsem, že se selektuje (celá) populace! Nic takového z daného odkazu nevyplývá, a tudíž jsem ani netvrdil, že vylývá!! Ten odkaz je na článek jednoho ecolucionisty! Co to je za slovo „postoval“? Možná, že to má být „poštoval“ – ale takové slovo NENÍ ve slovníku spisovné češtiny. Podle standardní teorie platí: Při selekci se selektují jedinci s vyšší hodnotou schopnosti přežít, zatímco jedinci s nízkou touto schopností se… Číst vice »
jhk - vlasta
jhk - vlasta

SSK má pravdu v tom, že selekce probíhá na úrovni jedince. O tom je právě kniha Sobecký gen, kde o tom dost obšírně mluví Dawkins už v úvodu.

SSK

Václav Dostál
Ano a selektováni jsou právě jen a pouze ti jedinci. Populace je sice množina těch jedinců, ale její vlastnosti jsou pouze pasivním důsledkem selekce na úrovni jedinců. Pokud tvrdíte, že se selektuje populace, tak se prostě mýlíte, což vyplývá i z toho odkazu, který jste postoval.

Václav Dostál
Václav Dostál

SSK:
Cituji dvě Vaše věty:
„Jedinec/gen je jednotkou selekce. Nikoli populace.“
„Jednotlivé prvky jsou jedinci a množina je jejich populace.“

SSK

Václav Dostál

Onen algoritmus jsem převzal z tohoto článku.

Asi jste ho pozorně nečetl. Všimněte si, že se selektují jedinci v té populaci nikoli ta populace jako celek. Ostatně máte to uvedeno hned v druhém odstavci: Hlavní myšlenka spočívá v tom, že na jednotlivé prvky množiny přípustných řešení pohlížíme jako na nějaké živé organismy v nějakém umělém životním prostředí.. Jednotlivé prvky jsou jedinci a množina je jejich populace. Ono to ani jinak nejde, když to celé vychází z populační genetiky.

Václav Dostál
Václav Dostál

Pro SSK
„Jedinec/gen je jednotkou selekce. Nikoli populace.“
Citát z http://cgg.mff.cuni.cz/~pepca/prg022/luner.html:
„Uvažujme populaci o 4 jedincích …“
[Nachází se Pod uvedením standardního genetického algoritmu]
Onen algoritmus jsem převzal z tohoto článku. Článek uvádím jako zdroj v hypetextovem odkazu „Lunera“ (což je autor)

Foton
Foton
Ne, nejedná. Evoluce genů/proteinů přirozeným výběrem se děje stejným evolučním algoritmem, který je využíván lidmi v informatice. Gény nie sú zložené z elektronických súčiastok, preto to nemôžeš porovnávať. Používate falošnú analógiu (Tento argument som si dovolil prepožičať od koroslava.) …Teraz k veci: Počítačové evolučné algoritmy majú tú výhodu, že sa nechá náhodne meniť iba určitá vlastnosť inak funkčného celku. Napr. návrh prevodoviek pomocou EA. Nechá sa meniť veľkosť, usporiadanie, typ ozubených kolečiek. Nie však už tvar kolečka na elipsu či štvorec. Prevodovka bude vždy fungovať, či bude veľkosť kelečiek taká… Číst vice »
SSK

Foton

Pričom sa jedná o niečo iné, než by malo fungovať pri hypotetickom vývoji génov / proteínov.

Ne, nejedná. Evoluce genů/proteinů přirozeným výběrem se děje stejným evolučním algoritmem, který je využíván lidmi v informatice. Takhle je to jednoduché.

Foton
Foton

SSK
Využití evolučního algoritmu není jeho přirovnání k vývoji genů.

Neklam, argumentujete tým. Pričom sa jedná o niečo iné, než by malo fungovať pri hypotetickom vývoji génov / proteínov.

Krom toho, evoluční algoritmy jsou na genech nezávislé.

Rovnako je na génoch nezávislá i spomínaná „vývojová metóda“ novej funkčnej informácie (ktorou klamete v evolučnej teórii). Rozdiel je len v syntaxii, sémantike, symboloch informačného systému a záznamovom médiu. Reč bola o informácii a tá je takisto na génoch nezávislá.

SSK

Václav Dostál

To nevadí, dalo by se použít statistiky a určit pravděpodobnost přežití větší populace jedinců. Existuje TATO funkce? Znáte ji?

To by se možná dalo, ale bylo by to hrubé nepochopení evolučního algoritmu. Jedinec/gen je jednotkou selekce. Nikoli populace.

SSK
SSK

Foton

Ale prirovnávať počítačové evolučné algoritmy k vývoju génov je už v poriadku – tak?

Využití evolučního algoritmu není jeho přirovnání k vývoji genů. Krom toho, evoluční algoritmy jsou na genech nezávislé.

Václav Dostál
Václav Dostál
Koroslavovi Vážený pane, podle mého soudu píšete rozporně nejen v otázkách genetických/evolučních algoritmů, ale naneštěstí i v obecném textu. Jednak píšete: „Jestliže se neshodneme v jednotlivosti (například jestli evoluční biologie řeší otázku vzniku života), můžeme s klidným srdcem diskutovat o jiných věcech, aniž by tím kvalita diskuze utrpěla,„, jednak diskutujete o „biologii“ (ET, genetických/evolučních algoritmech).“ Nejde ovšem JENOM o otázku vzniku života, my se neshodneme v NIČEM z dané oblasti. Fitness funkce …V reálném světě nelze na základě genomu jednoznačně určit, zda se daný jedinec rozmnoží do následující generace. To… Číst vice »
Foton
Foton
Koroslav: Třebas protože věta Gén je možné prirovnať k vete. je nepravdivá Ale prirovnávať počítačové evolučné algoritmy k vývoju génov je už v poriadku – tak? Třebas protože věta Gén je možné prirovnať k vete. je nepravdivá Proč? Pochopil jsem naprosto přesně. A hlavně jsem pochopil, proč chceš začínat u smysluplné věty (čili v lokálním minimu) a ne u náhodného řetězce znaků. Vravel som ti, že si to nečítal a nepochopil. Bolo zdôvodnené, prečo začínam u smysluplné věty. Lebo evolučné lži z toho tiež vychádzajú. (Hlavne, že sa bijete do… Číst vice »
jhk - vlasta
jhk - vlasta
Když to tak vezmu kolem a kolem, tak běžící počítač, který nemá na vstupu jakoukoli informaci, vlastně nic nedělá. Počítač, který se zapne provede pár základních operací, které jsou nutné pro nastavení některých částí hardware, pak se natáhne prostředí, ve kterém lze zadávat povely no a pak – pokud nemá počítač připojení k internetu, tak prostě stojí. Buď nic nedělá, nebo se po nějaké době uvede do spánku, či hibernace, pokud na žádném vstupu nepřijde nějaká podnětná informace. Podobně i buňka, pokud nedostane žádnou informaci zvenčí, tak nic dělat nebude… Číst vice »
jhk - vlasta
jhk - vlasta

Podle mě by to běžící program klidně mohl být.

jhk - vlasta
jhk - vlasta

DNA u lidí ani u nikoho jiného není program.

Může to být klidně i „běžící“ program – ale zatím je to asi spíše knihovna ve které se hodně čte. Neboli – zdroj informací. No – prostě je to velmi složité.

SSK
SSK
Odkud se vzala prvotní instrukce pro samovolný vznik protobuňky? Jak se z této jednoduché informace stal celý postup, zvaný algoritmus? A jak se tyto algoritmy samovolně spojily do velmi složitého programu, zaznamenaného v DNA u lidí? Tady lze v podstatě přestat číst. Vycházíte z chybných předpokladů. Žádná prvotní instrukce pro vznik protobuňky nebyla, takže se z ní ani nestal algoritmus. DNA u lidí ani u nikoho jiného není program. Takže po prvních dvou odstavcích tohoto článku můžeme uzavřít slovy autora: Zde platí, že ze špatného výchozího předpokladu dojdeme pomocí správné… Číst vice »
koroslav
koroslav

Ctený pán ale zabudol povedať malý detail. Že prečo

Třebas protože věta Gén je možné prirovnať k vete. je nepravdivá

Čiže si nepochopil, o čo ide. Prečítaj si to ešte raz a pomaly.

Pochopil jsem naprosto přesně. A hlavně jsem pochopil, proč chceš začínat u smysluplné věty (čili v lokálním minimu) a ne u náhodného řetězce znaků. Doporučuji ty tvoje logické klamy zkoušet na někom jiném.

koroslav
koroslav
Václave, navrhuji zabývat se v rámci srozumitelnosti diskuze jedím tématem po druhém. Začíná se nám to nepřehledně větvit. jaký smysl má pokračování naší debaty, jestliže „se shodneme, že se neshodneme“ Jestliže se neshodneme v jednotlivosti (například jestli evoluční biologie řeší otázku vzniku života), pak můžeme s klidným srdce diskutovat o jiných věcech, aniž by tím kvalita diskuze utrpěla. Toto tvrzení je velmi mlhavé a slučuje rozdílné věci. Co se rozumí slovy, že se velikost populace v různých (asi: po sobě následujících) generací mění? Znamená to obecný populační růst (s určitými… Číst vice »
Foton
Foton

Gratuluju, právě jsi objevil problém uváznutí v lokálním minimu. Na vysokých školách se to učí cca 15 minut po tom, co se poprvé zmíní sousloví evoluční algoritmus.

Čiže si nepochopil, o čo ide. Prečítaj si to ešte raz a pomaly.

Jinak se k té tvojí falešné analogii nemá smysl vyjadřovat.

Samozrejme, že je falošná. Ako inak. 😀 …Ctený pán ale zabudol povedať malý detail. Že prečo…

Václav Dostál
Václav Dostál
Koroslavovi: Vážený pane, mně se jeví, že pletete „páté přes deváté.“ I kdyby byla vina na mé straně, jaký smysl má pokračování naší debaty, jestliže „se shodneme, že se neshodneme“? Vezmu např. „otázku“ nedobrého chápání jednoho druhým. Mně např. vadí toto: Článek píše obecně o jakýchkoli algoritmech a Vy „vypichujete“ JEN ty genetické či evoluční. Také se jen obtížně orientuji ve Vaší logice. Budete asi tvrdit, že je to MOJE vina. „Nepsal jsem, že tam není žádný program, ale že tam není evoluční algoritmus“ [v DNA]. Tak bych se mohl… Číst vice »
koroslav
koroslav

Keď vetu „Jedzte deti!“ rozmnožíme na veľa jedincov a budeme ďalej aplikovať hore uvedený algoritmus, veľa možností, aký ešte iný zmysel z toho dostaneme, nezostáva

Gratuluju, právě jsi objevil problém uváznutí v lokálním minimu. Na vysokých školách se to učí cca 15 minut po tom, co se poprvé zmíní sousloví evoluční algoritmus.
Jinak se k té tvojí falešné analogii nemá smysl vyjadřovat.

Foton
Foton

Čo si chcel týmto údeným sleďom povedať?
Myslíš si, že keby hlavonožci žili na suchu, vydržalo by im dlho také oko pod priamym slnečným svetlom?

KTE
KTE

Foton
… a z komorového oka obratlovců se nikdy nestane komorové oko s kabeláží, v jakém je uspořádáno oko hlavonožců. A co jako?

Foton
Foton
EA používané v programování sledují tedy mnohem striktnější a jasněji definované podmínky, pracují s populacemi typicky o několik řádů menšími, než s jakými pracuje biologická evoluce a mají jasně stanovenou metodu ohodnocování jedince, kdežto v biologii je pro různé druhy různá funkce, která se navíc mezi generacemi může měnit. V programování EA končí splněním ukončovací podmínky, v biologii EA pokračuje dokud existuje život. Najlepšie sa veci ukazujú na príklade, pretože všetkého čoho sú evolucionisti schopní je len abstraktné rečnenie. Takže: Popíšme si teda na analogickom príklade o čo vlastne ide.… Číst vice »
Václav Dostál
Václav Dostál

Koroslav
Volím podobný postup jako minule: Vaši odpověď zkopíruji a uložím do určitého souboru. Myslím však, zda má smysl, abych svůj případný rozbor, přidaný k té kopii, zde měl uveřejňovat. Mnoho Vašich reakcí na mé výhrady je totiž podle mého soudu mimo téma článku. Kdybych svůj rozbor umístil do obecné diskuze, hrozilo by nebezpečí, že vaši případnou další reakci přehlédnui. Jednak se do obecné diskuze dívám spíše jen občas, jednak mi začíná kolabovat počítač a také se raději věnuji užitečnější práci než podle svého mínění zbytečné debatě.

koroslav
koroslav
Dobrý den Václave. Píšete: Mám totiž s Vámi špatné zkušenosti. Což je zvláštní, vzhledem k tomu, že s Vámi diskutuju slušně a nepamatuju si, že by snad kdy mezi námi došlo k nějaké nekorektní diskuzi. Pokud ano, pak mě to mrzí. Co se týče chemikálií, tak tam došlo k nepochopení. Věta: Je podivné, že některé chemikálie používané v technice či výrobě své tvůrce potřebují, a jiné žádného tvůrce nepotřebují je myšlena takto: Některé chemikálie v technice či výrobě cvé tvůrce potřebují (například polymery), zatímco jiné (myšleno ty přírodní – např… Číst vice »
Václav Dostál
Václav Dostál
</em<strong>>„Je podivné, že některé chemikálie použí<em></em>vané v technice či výrobě své tvůrce potřebují, a jiné žádného tvůrce nepotřebují“ Analogie nesedí. Hmotné chemikálie a nehmotné algoritmy se od sebe liší hmotností. Takže při jejich porovnávání musíme být obezřetní. Pokračování v následujícím odstavci. Důležitější však je Vaše tvrzení, že chemikálie v technice či ve výrobě svého tvůrce nepotřebují. Toto neplatí. Některé chemikálie jsou přírodní a jiné jsou umělé. Mezi ty přírodní patří zejména voda, jíž se používá k ředění jiných chemikálií. Avšak NIKOLI v přírodním stavu, nýbrž v destilovaném (chemicky čistém)! A… Číst vice »
rafael
rafael

Vaclave nemusis, koroslav to vysvetlil a uplne jednoznacne

Václav Dostál
Václav Dostál
Koroslavovi (a také jiným účastníkům tohoto webu) VVážený pane, Váš příspěvek jsem si uložil do souboru zvaného „Reakce na Tvorbu algoritmů“ Podle mého soudu je ve vaší reakci několik logických chyb. Váš příspěvek chci rozebrat a výsledek sem napíši. I když mohu předpokládat, že mi bude určení toho rozboru Vám málo platné. Mám totiž s Vámi špatné zkušenosti. Přesto odpovědět „musím“, hlavně kvůli jiným čtenářům tohoto webu. Prozatím bych naznačil, jak asi svou reakci chci napsat: Dejme tomu, že ET se nezabývá vznikem života. Ale zabývá se jeho rozvojem neboli… Číst vice »
koroslav
koroslav
Dobrý den Václave, Bohužel je článek poměrně matoucí a v několika ohledech vyloženě špatný. Zkusím zde uvést hlavní body, ve kterých se mýlíte. Je podivné, že některé algoritmy – používané v technice či ve výrobě – své tvůrce potřebují a jiné – zaznamenané v živých organismech – žádného tvůrce nepotřebují. Je podivné, že některé chemikálie používané v technice či výrobě své tvůrce potřebují, a jiné žádného tvůrce nepotřebují Tato jednoduchá analogie by Vám měla ukázat, proč je Váš podiv zbytečný. To,že existuje něco člověkem vymyšleného, neznamená,že nemůže existovat něco jiného,… Číst vice »
wpDiscuz